KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00006046G001Help
Entry
GSTEN00006046G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00010  Glycolysis / Gluconeogenesis
tng00562  Inositol phosphate metabolism
tng01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSTEN00006046G001
   00562 Inositol phosphate metabolism
    GSTEN00006046G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     GSTEN00006046G001
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     GSTEN00006046G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2 DEC-1_N Host_attach
Motif
Other DBs
NCBI-ProteinID: CAF91346
UniProt: Q4T6Y6
Position
undetermined
AA seq 519 aa AA seqDB search
MSPPSAHRTALVLTALSFSLRCCWSSFSSAPEIPLIAPYFGTKTRYEEVNPQLLRDVLFV
DRSVLKAPASEGCSPPLPDRQEHPQIQRLSELVRREASRGSERWQQDIQSRWENWFSEDM
DGQLVTKGKAELRQLAARLSALFPALLAEENLRRISLRSSSKHRCVSSVEALQEGLWRTA
GDPGATSAPPPAPGPAAHRPTPVVLADMQYRHVIDDQLLRFFERCRGYVEGVENNRTALQ
EVERFKHGEEMEALRRRTARRLGLHQQRLTTGEHTHTHTHTHTHTHTHTHTHTPPSSPLH
SRPSRLADLLEAAFFICSYELSIRSVHSPWCFLFSEEDAKVGLEGTGVPAGAAAHGDCVQ
VLEYQADLKQYWKRSHGHMISSLSSCPLFHHIFRTLDRAGRPRRSTEELPEPASILVGHA
ETLLPLLSLLGLHKDQTPPTASNYRTQHGRSFRTSHMVPYAANLLFVLYDCQRGPRLQLL
LNESPVRFPGLKDDAPLYRDVRATYRHLLDGCDFDRECE
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgtccccgccgtcagcgcaccgaaccgccctggttctgacggcgctcagcttctccctc
cgctgctgttggagctccttctcctccgccccggagatcccgctcatcgctccttatttc
gggacgaagacccggtatgaggaggtgaaccctcagctgctgcgggacgtcctcttcgtg
gaccggtcggtcctgaaggctccggccagcgagggctgctccccgccgctacccgaccgt
caagaacatccgcagatccagagactgagcgagctggtccgcagagaagcttccagaggc
tcggagcgatggcagcaggacatccagagccgctgggagaactggttcagcgaggacatg
gacggtcagctggtgaccaaggggaaggcggagcttcgccagctggcggctcggctctcg
gccttgttcccggcgctgctggcggaggagaacctgaggaggatcagcctgaggagcagc
tccaagcaccgctgcgtcagcagcgtggaggccctccaggagggcctgtggaggacagca
ggtgaccccggggccacgtcagctccgcctccggcgcctgggcccgccgctcaccgtccc
acgcccgttgtcctcgcagacatgcagtaccggcacgtcatcgacgaccagctgctgcgc
ttctttgagcgttgtcgtggttacgtggagggcgtggaaaacaaccgcacggcgctgcag
gaggtggagcgcttcaagcacggcgaggagatggaagccctgaggaggagaacggcccgg
aggctgggccttcatcagcagcgcttgaccaccggtgaacacacacacacacacacacac
acacacacacacacacacacacacacacacacacacacaccaccctcctctccgcttcac
tcccgtccgtctcggctggcagacctgctggaagcggccttcttcatctgctcctacgag
ctgtccatccggtccgtccactcgccctggtgcttcctgttcagcgaggaggacgccaag
gtaggactggaggggacgggcgtccccgctggggctgctgctcatggggactgtgtccag
gtgctggagtaccaggccgacctgaagcagtactggaagcgctcccacggtcacatgatc
agcagcctgtccagctgtcctctgttccaccacatcttcaggactctggacagggcagga
cgtccccgcaggtccaccgaggagctgcctgagcccgcctccatcctggtgggccacgcc
gagacactcctccccctcctctcactgctggggctccacaaggaccagactccgcccacc
gccagcaactaccgcacgcagcacggtcgaagcttccggaccagtcacatggttccgtac
gccgccaacctcctgttcgtgctgtacgactgccagcgcggcccgcggctgcagctgctc
ctcaacgagtctccggtaagattcccgggactcaaggacgacgccccgctgtaccgggac
gtccgggccacctaccgccacctgctggacggctgtgacttcgacagggagtgcgag

DBGET integrated database retrieval system