KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00006711G001
Entry
GSTEN00006711G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00100  Steroid biosynthesis
tng01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    GSTEN00006711G001
Enzymes [BR:tng01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     GSTEN00006711G001
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-ProteinID: CAF91793
UniProt: Q4T5N9
Position
undetermined
AA seq 247 aa
LVLQVLINFSMALAEMERQQLDAPSASMLLVNLFQLLYVLDGLWNEEAILTTMDLMHDGF
GFMLAFGDLVWVPFTYSLQAFYLVDHPSPLSPAAISAIVALKAVGFYIFRKSNSEKNAFR
RNPADPRLAHLKSIPTATGKSLLVSGWWGVVRHPNYLGDLLMALAWSLPCGESVCSTRGC
PLARSAVLSPLSPPGFQHLLPWYYMIYFLILLVHRDSRDMSECRRKYGRAWEEYCRTVRF
RLVPHLY
NT seq 744 nt   +upstreamnt  +downstreamnt
cttgtgctccaggttctgatcaacttctccatggctctggctgagatggagcggcagcag
ctggacgctccgtcggcctccatgctgctggtcaacctcttccagctgctctatgtgctg
gacggtctctggaacgaagaggccatcctgaccaccatggacctgatgcacgacggcttt
ggcttcatgctggccttcggcgacctggtgtgggttcccttcacctactcgctgcaggcc
ttctacctggtggaccaccccagccctctgagcccggctgcaatcagcgccatcgtggct
ctgaaagctgtgggcttctacatcttcaggaagtccaactctgagaagaacgccttcagg
aggaacccagcagacccccggctggctcacctgaagagcatccccacagccacggggaaa
agcctgctggtgtcgggctggtggggcgtggttcgccatcccaactacctgggagacctg
ctgatggccctggcctggtccctgccctgcggtgagtccgtgtgcagcacccgcgggtgc
ccgctggcccgctccgctgtgctcagccctctctctcccccaggcttccagcacctgctg
ccgtggtactacatgatctacttcctgatcctgctggtgcaccgcgactcccgggacatg
agcgagtgcaggaggaagtacggccgtgcctgggaggagtactgccggactgtgcgcttc
cgcctcgtccctcacctgtactga

DBGET integrated database retrieval system