KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00006765G001
Entry
GSTEN00006765G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K02223  circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tng03000]
    GSTEN00006765G001
   03036 Chromosome and associated proteins [BR:tng03036]
    GSTEN00006765G001
Enzymes [BR:tng01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     GSTEN00006765G001
Transcription factors [BR:tng03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    GSTEN00006765G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic type
  Histone modification proteins
   HATs (histone acetyltransferases)
    GSTEN00006765G001
SSDB
Motif
Pfam: PAS_11 PAS_3 HLH PAS PAS_9 HAUS-augmin3 ThiD2
Other DBs
NCBI-ProteinID: CAF91831
UniProt: Q4T5K1
Position
18
AA seq 832 aa
RDDCSIFDGLMEEDEKDKAKRVSRNKSEKKRRDQFNVLIKELGTMLPGNTRKMDKSTILQ
KSIDFLCKHKEIAAQSESSEIRQDWKPPFLSNEEFTQLMLEALDGFFIAIMTDGNILYVS
ESVTSLLEHLPTDLVDQNLLNFLPIGEHSDVYKALSTHPSDPESLNTDFMKTKNHMEFCC
HMLRGAIDPKEPPVYEYVRFIGNFKSLNNVPNVTRNGLAGVLQRSLQPAFDDQVCFVATV
RLAKPQFIKEMCTIEEPNGEFTSRHSLEWKFLFLDHRAPPIIGYLPFEVLGTSGYDYYHV
DDLETLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYHQWNSRPEFIVCTHTV
VSYAEVRAEQRRELGIEESNPEVTADKSQDSGSESQLNTSSLKEALERFDHSRTPSTSSR
SSRKSSSHISDNTCTLMEFSAQVNAMQHLKEQLEQRTRMIQANIQRQQEELRHIQEQLQR
VQGQGIQPQRQLPQPQQAQPQSSVSAPLYNTMMISQPGQPNVLQISTTLPQNNAQQGTAV
ATFTQDRQIRFPTGQQLVTKLVTAPMACGAVMVPTSMFMGQVVTAYNPFSGQQQGGQTQT
LTLQAAQPSQGQPDGQNQTAVVAQSGQQGQQQQQQFLQGTRLLHSNQSTQLDLAGLAFAT
ANQQGCMCGPGNTPTAAATAAAAATTTAAAAAAAAATTATAAAATETTAAATTIPPPAAP
AAAETTAPETAKSAFVAQDRQHQQPAAVKSGYKRGKLFKDCFFFFFFFDHVAVGNLPTPP
PSPRNRYPLFLLQKKSKSFGVCKELPEDCHHGNTDGFIILLLLTKGRGVRVL
NT seq 2499 nt   +upstreamnt  +downstreamnt
agggatgattgtagcatctttgatgggttgatggaagaagatgaaaaggacaaagcaaaa
cgtgtgtcccgcaacaaatctgagaagaaacggagagaccagttcaatgtccttatcaag
gagcttggcaccatgttgccaggcaacaccaggaaaatggataagtccaccatactgcag
aaaagcatcgacttcctgtgtaaacataaagagattgctgctcagtcagagtccagtgag
atcaggcaggactggaaacctccatttcttagcaatgaggagttcacccaacttatgctg
gaggctctggatggattctttatagcaataatgactgatgggaacatcctctacgtgtcg
gaaagtgtcacatctctattagaacacctaccgaccgatttggtggaccagaatctgtta
aacttcctgccaatcggggaacactctgatgtgtacaaggctctgtctacgcaccccagt
gacccagagagccttaacactgatttcatgaagactaagaaccatatggagttttgctgc
catatgctgcgaggggccattgaccccaaagaaccgcctgtatatgaatatgttcgattc
attggcaatttcaagtcgctcaataatgttccaaatgtaacaagaaacggtttagcggga
gtgttacagcggtctctacaacctgcatttgatgaccaagtatgctttgtagccacagtt
cggctagccaaacctcagtttatcaaggagatgtgtacaatagaggaacctaatggagaa
tttacatctagacacagtctagaatggaagtttcttttcttagaccacagagctccacca
attataggctacttaccgtttgaggttctgggaacatcagggtatgactattaccatgtg
gatgacctggagacactggccaagtgtcatgaacacttgatgcagtatggaaaagggaag
tcctgttattaccgcttcttgactaaaggtcaacagtggatctggctccaaacgcactac
tatataacctatcaccagtggaactcacgacccgagtttatcgtctgtacacatacagtt
gttagctatgcagaagtgagggcggaacagcgcagagagttaggtattgaggagtccaac
ccagaagttaccgcagataaaagtcaggactctggttcagagtcgcaactaaatacgtct
agcctcaaagaggctctagagagatttgaccacagccggacaccctctacttcctcaagg
agttctcgcaagtcctcttctcacatctctgataacacttgcactttgatggagttctca
gcacaggtaaacgcaatgcaacatctaaaggagcagctggagcagaggacgaggatgatc
caggccaacatccagcggcagcaggaggagctgagacacattcaagagcagctgcagcga
gtccagggacaagggatccagccccagcgtcagctgccgcagcctcagcaggctcagcct
cagagctccgtctctgctcccctctacaacactatgatgatttcccagccagggcagcca
aacgtgctgcagatcagcaccactctgccgcagaacaacgcacaacagggcaccgctgtg
gccactttcacacaagaccgacagatccggttcccaacaggtcagcagctggtgacaaag
cttgtgacagctccaatggcatgtggagcagttatggtgcctacgtccatgttcatggga
caagtggtcactgcctacaatccctttagtggtcagcaacagggtggacaaacccagact
ctgactctgcaagcagctcaaccttctcagggtcagcctgatggccaaaaccagacagcc
gtggtggctcagagtggccagcaagggcagcagcaacaacagcaattcctccagggaacc
cgtcttctccacagtaaccagtcaactcagctggatctggctgggctggcttttgccact
gcgaaccaacagggctgcatgtgtggcccaggcaacacaccaaccgcagcagcaacagca
gcagcagcagcaacaacaacagcagcagcagcagcagcagcagcagcaacaacagcaaca
gcagcagcagcaacagagacaacagcagcagcaacaacaatcccaccaccagcggcacca
gcagcagctgaaaccacagccccagaaaccgcaaaaagcgccttcgtcgcacaggaccga
cagcatcagcagccagccgcagtgaagtctggatacaaacgtggaaaactcttcaaggat
tgctttttttttttttttttttttgatcacgtggctgttggcaacctccccaccccacca
ccctctcccagaaaccgttatcctttgttcctccttcagaaaaaaagcaaaagttttgga
gtctgcaaggaactccctgaggattgtcatcatggcaacacggatggatttatcatttta
ctcctcctcaccaaaggaagaggcgtgagggtgctctag

DBGET integrated database retrieval system