KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00007193G001Help
Entry
GSTEN00007193G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng03040  Spliceosome
tng04010  MAPK signaling pathway
tng04141  Protein processing in endoplasmic reticulum
tng04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:tng00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    GSTEN00007193G001
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    GSTEN00007193G001
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00007193G001
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    GSTEN00007193G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tng01009]
    GSTEN00007193G001
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tng03041]
    GSTEN00007193G001
   03009 Ribosome biogenesis [BR:tng03009]
    GSTEN00007193G001
   03110 Chaperones and folding catalysts [BR:tng03110]
    GSTEN00007193G001
   04131 Membrane trafficking [BR:tng04131]
    GSTEN00007193G001
   03051 Proteasome [BR:tng03051]
    GSTEN00007193G001
   03029 Mitochondrial biogenesis [BR:tng03029]
    GSTEN00007193G001
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tng04147]
    GSTEN00007193G001
Protein phosphatases and associated proteins [BR:tng01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     GSTEN00007193G001
Spliceosome [BR:tng03041]
 Complex B
  Other components
   Prp19 complex
    GSTEN00007193G001
 Complex C
   Prp19-CDC5 complex
    GSTEN00007193G001
Ribosome biogenesis [BR:tng03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    GSTEN00007193G001
Chaperones and folding catalysts [BR:tng03110]
 Heat shock proteins
  HSP70 / DNAK
   GSTEN00007193G001
Membrane trafficking [BR:tng04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    GSTEN00007193G001
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    GSTEN00007193G001
Proteasome [BR:tng03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    GSTEN00007193G001
Mitochondrial biogenesis [BR:tng03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    GSTEN00007193G001
Exosome [BR:tng04147]
 Exosomal proteins
  Proteins found in most exosomes
   GSTEN00007193G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C EF-hand_7 PIN_8 DUF2666
Motif
Other DBs
NCBI-ProteinID: CAF92124
UniProt: Q4T4Q8
Position
3
AA seq 609 aa AA seqDB search
MSAAKGLAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VALNPNNTVFDAKRLIGRKQDDPTVQADVKLWPFKVIGDGGKPKIQVEYKGEEKSFYPEE
ISSMVLVKMKEIAEAYLGQKVSNAVVTVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYDGIFEVKSTAGDTHLGGEDFDNRMVNHLMEEFKRKQKKDISQNKRALRRLRTACE
RAKRTLSSSSQASIEIDSLFEGIDFYTSITRARFEELCGDLFRKTLEPVEKALRDAKMDK
GQINDIVLVGGSTRIPKIQKLLQDFFNGRELNKSINPDEAVAYGAAVQAAILTGDTSGNV
QDLLLLDVAPLSLGIETAGGVMTALIKRNTTIPTKQTQIFSTYADNQPGVLIQVYEGERA
MTKDNNLLGRFELAGIPPAPRGVPQIEVTFDIDANGILNVTAVDKSTGKENKITITNDKG
RLSKEEIERMVQDADKYKAEDDHQREKVAAKNSLESYAFNMKSTVQDDNLKGKISEEDLK
KVVDKCEETITWLENNQLADKEEYQHQQKELEKVCNPIISKLYQGGMPGGNPGGPPQSSS
QGPTIEEVD
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagctaaaggcctagcgatcggcatcgacctgggcaccacctactcctgtgtg
ggggttttccagcacggaaaggtggagatcatcgccaacgaccagggcaacaggaccacc
cccagctacgtggccttcactgacacagagaggctcatcggggatgcggcaaagaaccag
gtggccctgaaccccaacaacaccgtgtttgatgccaagaggctgattggaagaaagcag
gacgacccaacagttcaggctgacgtcaaactctggccgttcaaggtgattggggatgga
gggaagcccaaaatccaggtggaatacaaaggagaggaaaagagcttctaccccgaggag
atttcctctatggttctggtgaagatgaaggagattgcagaggcttacctgggtcagaag
gtgtccaacgccgtcgtcacggtcccggcctacttcaacgactcccagagacaggccacc
aaagacgccggcgtcattgctgggttgaacgtcctgagaattatcaacgagcccacagcc
gccgccatcgcctacgacggtatctttgaggtgaaatccacagctggagacactcacctg
ggtggagaagactttgacaaccgcatggtgaaccaccttatggaggagttcaagaggaag
cagaagaaggacatcagccagaacaagagggccctgaggaggctgcgcacagcttgtgag
agggccaagagaaccctgtcctccagctctcaggccagcatcgagatcgattcactgttt
gagggcatcgacttctacacctccatcaccagggctcggtttgaggagctgtgcggggac
cttttcagaaaaaccttagagcccgtggagaaagccctgagggatgccaaaatggacaag
gggcagatcaacgacattgtcctggtcggaggctccaccagaatccccaaaatccagaaa
ctcctgcaagacttcttcaacggcagagagctgaacaagagcatcaacccagacgaggcc
gtggcttacggcgctgctgtccaagccgccattctgacaggagacacctcagggaacgtt
caggacctgctgctgctggatgtggcccctctgtctctgggtatcgagacagccggagga
gtcatgacggccctgattaaacgcaacaccaccatccccaccaagcagacccagatcttc
agcacgtatgccgacaaccagcccggggtcctcatccaggtctacgaaggagaaagagcc
atgaccaaggacaacaacctgctgggcaggtttgagctggcgggcatcccacctgccccc
cgaggggtcccgcagatcgaggtcaccttcgatatcgacgccaacggcattttgaacgtg
actgcggtggacaagagcaccggcaaagagaacaagatcaccatcaccaacgataagggc
cgtctgagcaaagaggagatcgagaggatggtgcaggatgccgacaaatacaaagctgag
gacgaccatcagagggagaaagtcgctgctaaaaactccctggagtcctacgccttcaac
atgaagagcactgtgcaggacgacaacctgaagggcaaaatcagtgaagaggacctgaag
aaggttgttgacaagtgtgaggagaccatcacctggctggagaacaaccagttggctgat
aaagaagagtaccaacaccagcagaaagagctggagaaagtgtgcaaccccatcatcagc
aagctgtaccagggaggaatgcctggaggcaacccaggaggacccccccagagcagctcc
caggggcccaccattgaggaggtcgactaa

DBGET integrated database retrieval system