KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00007498G001Help
Entry
GSTEN00007498G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K12567  titin [EC:2.7.11.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tng01001]
    GSTEN00007498G001
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tng04131]
    GSTEN00007498G001
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:tng04812]
    GSTEN00007498G001
   04147 Exosome [BR:tng04147]
    GSTEN00007498G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     GSTEN00007498G001
Protein kinases [BR:tng01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   GSTEN00007498G001
Membrane trafficking [BR:tng04131]
 Others
  Actin-binding proteins
   Others
    GSTEN00007498G001
Cytoskeleton proteins [BR:tng04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     GSTEN00007498G001
Exosome [BR:tng04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GSTEN00007498G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 I-set Ig_3 ig Ig_2 Pur_ac_phosph_N V-set fn3_2 C2-set_2 Ig_4 Ig_6 THB Ig_5
Motif
Other DBs
NCBI-ProteinID: CAF92338
UniProt: Q4T444
Position
undetermined
AA seq 9369 aa AA seqDB search
ESAQAPKFDVPLEPVTVNEGEKLSLKCHVIGSPPLKVQWMKDRRELKSSRETQITFVDGS
VCLEVEAASKTEAGDYLCKASNAAGSTFCKSRVSVKEKEFRAVPAEAVVPAISTPVRRLD
NLFFIEEPKNISATEKGTATFIAKIGGEPIPNVKWMKGKWRQITPGGRISIHHKGQDAKM
EIREVTKSDSGTYRCVASNKHGEIECSAEMEVTKKQEVGEFGDVRVMLKKTPSKQKSPKK
EEWNIVELLRGHDPKEYEKILQEHDIHDYRAILQAMDLLKKEKEAEPSKTVDQVDRVEEE
DMARFIQQLESHIAAEPVSVLEDITDQKTAENQSATFRCRIQINYPEISLTWYKGTRRLE
QGHKYEISSVGDLHCLKVNDCDPSDEGDYRVVCGPHISTAMLAVAGKCPDLLFSCCVGSD
LGEISRTELGKVPHEERSSADEHIEKMQVKKQSEEKTAASLQTAQDKGPVSAPGPTKDGK
PAEEPPKGRGRGFGVRQTPSPGDGGRGRGLRPGGKGPSPPEEPFGGFKLKAVPLKFVKKL
QDIVLQEAESIGSSAVFECQISPSTAITSWMKDGGNLREGPKYKFTADGKDRKLNILDVQ
LSDTGEYTCVARNAGKEITCTAKLIVEELPVKWVKELEPETTCMKGQPMYLTCELNKERD
VTWKRNGAVLKKKAGKVAINIIGLQHAVTIQNATEEDTGAYTCEVEGREDISTTTNVKVL
EIIKDWLVKPLRDQHVKPKSKATFKGELFKDTPNWKWLKGETEITPSEKMEIAKDGANVT
LTINNCQPDDVSEYTIEVEDRRYTAKLTLGGAVRRRFQEREAEILKPLASLEVVEKEEAN
FDTEISEEDIIGEWKLRGQVLTRSPTCDIKLEGRKRFLTLKNVQVDQAGEVSYQALNAVT
TGMLTVKELEMGFVDPLKDVSVPEKKQAKFECTVTKEVPKVMWFKGAEIVTPGPKYEIID
DGLKHMLVINSCEFDDEAQYTIEVLGQRSSSQLRVEGIRLNFVQPLQDQTVKEGKTAHFE
LELTHDNVPVLWYRNEVKLHVSRTVLMHVEGKKHRLEMRTVSLDDTCQIKAEAKGIYSVA
QLTVVEGDAVFVVKLQDFAATEKDELLLSCELSKDVPVVWYHSEKEITASKTVVLKSEGT
CRSLLLKRVEQSSKGTYTCDCGTDKTSAVVDVQARDVKIVRPLYGVELFDGETARFEVEI
SEDDVRGQWKLNGDVLSRSPDVDIIEDGSKHTLILYNCRVAMAGEVAYTAANAKCSAKLK
VKELPLNFLTSLNDVQVYEKDEARFEVELSRPPKSFRWLKGSQELQSDEKYELIQEGHTY
VLLIRSAIYEDEAKYMFEAEDKRTACKLILQGSKNQKQKKFEMCSISLFLNHHERVVGFQ
NLICPTFLVAGIRLEFVKPIKDVTVKERETAEFSVELSHENISVVWYKNDIRLHPSKVIH
MSDHGKIHTLAFKEVSIDDTSMIKVEAMDKTVTAMLTVIEGDLYFTTKLQNYTAVEKDEV
KLRCELSKAIGDVKWFKDGKELTPSKNIAIITDGKKRILTVRKAEKANIGEYTCDCGSDK
TTAKLNIEERDIKIVRPLYSVEVTETETAKFETEISEDDVHGNWKLKGEALQQSADVEMK
EEGTRHMLVLYNVHMDMAGAVDFSAANARSSAQLRVKARSVGLVRPLKDVMVTAGETATF
ECELSYEGIVVEWFLGGQKMEAGERVKTRVAGRAHALTIRDVNLSEAGEVKLTAKDFQTQ
AHLIVKEPPVEFTKPLEDQTVEEDSTVTLECAVSRENAEVRWFRDGQELRKTKKFDLLSL
GCKRMLVIHNCSSEDIKMYTCDTKDFKTSCYLDVTPPHVEFTKLLQDVEVREREAAKFEC
EVSRESAKVRWFKDGSEIRKGKKYEITASGVQRTLIIHKSGFDDEAEYECDARTSKTSGL
LTVIEEAPKFTKNLSNVEGMETDSVKMICEVSKASAEVTWYRGEEELPEVGRYEQIMDGR
KRILIIKGLRMEDAGQYTCRLSPNIKTSAVLQLNELAAEFISRPQNQEVVEGQAAEFTCS
VSKETYEVKWFRGDKELENGDKFVIVSEGKRRVLTVKNCELKDEGGYVAHIGAIKASADL
LVTEKLRVITPIKDTEVKEGSEIVFNCEANAEGAKAKWLKNEETIFETSKYMMAQRDNVF
SLRIRDAQKTDEASYTVSLTNQRGEQATCTASAKVAEEKHRFLQPIEDIETQEKKTISFV
CKVNRPEVMVKWTKAGQEVALSKRIVYRADGLKHTLTIKDCVMEDEGEYTAVVGEDRCTA
DLMVSEAPADFTALLKDQTVTEFEDADFTCKLNKEKASVKWYKNGREIREGPRYHMQREG
KVCRLIIKECRPDDECEYACGMDERRTRARLFVEETPVEIIRPPQDMLEPPASDIVFEVE
LNKDRVEVKWMRNNMIIVQGDKYQMISEGKIHRLQVCEIRPRDQGEYRIVAKDKDARAKL
ELAAVPKIKTTDQKLVTDAGKPFIMRVPYDAYPRAEAEWFFEDTSLPVQNIDTSVDKTEY
RLKSPSKEDQGQYKVVISNKHGAAEAFIVLDVIDVPGSVKNLRVLDTADGEVSLAWEEPE
SDGGSKIIAYVVERRDVKRKTWALATDRADTPEYCVTGLHKDSAYLFRVCARNRVGSGPA
VVTEDAVQAKNKFDVPDAPEDVAVETVNKFGATISWKPPKFDGGSEITAYVIELRDRTSV
KWEATLECSPHDLSATLNDVVENKEYIFRVRAENRAGVGRPSPATNPVKIMDPIERPSPP
LNLNFSDQIKTAVTLTWETPVSNGGSMITGYIIEKCEDGTDKWLRCNARLCPDLSYRVSG
LKPGQNYLYRVCAENAAGVSDPVQQLGPLLADDPHVGPTFDLSGFRKGLEVIVPQPLTIR
VPITGYPTPVARWIFGEKELNADERVSLVTKPTFTELTVAPSMRPDKGTYTLQLENDISS
VSGEVEVNVIACPSAPKDFKVAEVSRHHVHLMWEAPEHDGGSPVTHYQIEKREVSRKTWV
KVASGVLDLEHTVTDVIEAKEYLFSVTACNKCGPGEPAYIDEPVNISSPATVPDPPENLK
WRDKCAKSIFLLWEPPKYDGGSPVKGYVVDKCQRGTDKWEPCGDPLPELKLQVSGLLEGQ
WYSYRVRAFNKLGASRPSRATDDIQAVDAREPPEIQLDVKLLAGLTARAGTKIELPADVK
GKPAPRVKWTKADLVLRADDRVTIDTQPDHSKLSIANTTRGDTATYIIEAVNVCGRATAT
IDVNILDKPGPPAAFDISEITSESCCLAWNPPRDDGGSPITNYIVESRQTDKEEWIKLSA
TVKHTTFKACKLTGMKEYIFRISAENQFGIGEPAEHVPIVAKYSFDPPGSPTRVTPSDIT
KDAVTLTWFEPDEDGGSPITGYWVEKFDPESEKWIRCNKLPVKDTSFRVKGLRTKKKYRF
RVLAENLAGPGKASSETDPVLIKDPIDPPWAPGKPAVRDVGKTSALLAWTRPEHDGGAKI
EGYIIEFQKTGSEEWVCIAENVPLTEHQLQGLKEKQEYSFRVKAVNKAGESEPSEPSDPV
ICKERLYPPSPPQWLEVSNITRINAELKWQVPSSDGGSPITNYVVEKRDVRRKTWQSVDT
TVKDLKYIVSPLNEGSLYVFRVAAENSVGMSEFCELEDAVLAKDTFTTPGPPYALTVLEV
TKRHVELKWEAPKSDGGRPITKYVIEKKEKLGTRWLKCCKTPDKQSQFKVTDVDEGSEVQ
FQVRAENEAGVGDPSEPTEILNIEDPTSAPSPPLDLTIPDASREHITATWKPPAKDGGCP
ISGYHVEVAEARPELKWLRVNNRPIKELKFRIDDGIKPEKKYVIRVRAINSVGTGDPSEI
TDKIFTKDPDSAPTLKLEAQDIVVIEGEKLHLKVPYKAIPTPTMVWQKDTLECKVDDRLS
MTLEMNDAHLELLKCTHADAGTYTIVLKNALGMVTGTVNVKVIGRTFFILPVSSSACSKF
DACKDSQKLFGFLESTLLFCTTATGLPGQCKDIRSTDITKNSCQVSWEMPEDDGGSPISS
YTLERREASKKTYMPVLSGENVLTHTVKDLYVNCEYFFRVKAVNKVGAGQYLELRNPVIT
EEVKLPMYLLILNFDLTEKPDPPLQVETCDPTSKSITITWKAPDNDGGCPIQGYIVEKIE
KDGDRYERVTPSLVPGFSFVVTGLKENMEYQFRVRAENVAGVSEPSRSTQLLKAADPVDK
PGAPINFTFDEIRNTSVICNWEPPEDDGGSEILNYILEKRDYKKEEVGWITITSTLKGNS
FPVTKLIEGKEYIFRVTAENKFGCGPPCISGPLTAKNQFDPPDAPNTPRVHEVTASTARL
SWHEPKDNGSPILGYWIERKEVNSKHWTRVNRALINSLEVKVSNLMEGLTYIFRVCAENL
AGPGPFSEPSDRTTAMDAILPPGPPTPWIVDTGKDFVIVAWKPPLYNGGGDILGYHVEKV
LAGEKEWTRSTEFRCKDLTFTVTGLIEGADYYIRVVAINDAGPGAPGVTEPVMVKEPQES
PVVEFDASVKKGVIIRAGEPLKLPAVVTGRPQPEVKWAKDEGEIDKDRMIVETEGKNSSL
FIKKTTRTDHGKYKISGTNSSGTKSAETRVDIMDVPGPVVDLKTVTVTKKNITLTWSDPH
DNGGSDIIGYDVLRKDAKMKLFRHPMETASCKCDIQGLLAGEEYDFRVIARNKYGDGAPS
DLGPILAQDPKGTPSAPEKLHYTDRGKTTIMLAWQPPRTDGGSPIRGYYVEKMRSDSNEF
EVANRKIFTECCGTIENLSENQEYQFRVKAVNEVGDGEPSKAITAKIQDDELAPVITILK
FFKSNAIIIKKGSAIDIPAEVKGLPLPSLQWVKDDVVIETPVEDKMIMETEEMDRTTLRT
KIAIPETVRQDKGNYKLVAENCFGKAQHVIRVEILDRPLPPRNVVVSDIKADSCYLTWDV
PEDNGGSEITNYIIERRDASKKKSDFEVQTTNLIDRRYGVYKLNVNGAYQFRIKAENKYG
ISDGCDSEKVQLSDPFGLPGPPRNPKIIAATATTMTLTWDPPLDNGGSTIQGYWLEKRER
GAVYWGRVNRAPVTKPAVKGLQYTVLKLIEGTEYQFRIAACNAAGVGPPSEASECRFAVD
PCNPPSSPGAPEVKDKTKNSITLSWSPPDKDGGSPVKGYIIEVHEEGCPDWRRVNPADKL
HPSTELFVSDLKEGKKCRFRIYAVNAAGNSEPARTAEILTQDILIEPTVTLDVSAHDLLN
CRADSTIRIPATITGRPLPKVTWTFDGTAETEKKNDLHILPVDSEVRPFSLGELIYHNAF
KSLTLFPHVSFQIHSSDTTSVVTIPISKLAHSGRYIINAESPAGHKVVKVRVTVLDLPGP
PRDLKVSDVTRGTCRLTWKPPQCDGGERVKSYFIEKKTVHGKAWTKVNPACAAQSLVVPD
LNNGQEYLFRIRAENRFGFGPFTQTIERTKASDPINPPDPPTRLKIQNVHKGAVTLTWKA
PKNDGGSPVTHYSVDLLCWDASGTQKEHWRRCNRRDVESTRFKVEDLTYGDEYEFRVVAY
NEAGPSRPSTTAGPITIQDQSCAPSIELQEFMEVEQGSDISIIAKIRGCPFPTLTWYKAP
PHKSDNKVEVQYDEHINKIVSDDSCTLLIQQGKRPDTGLYTLMASNSLGKASKEMRLNVL
GRPGPPSAPIKFEEIGAERITLSWLPPKDDGGSKVTNYVIWRRVANRKSWVPVTSEPKER
IWTVENLMTGHEYVFRVMAQNKYGVGEPLDSEPEVARDLYIGPEVDLDTSVKEKMVVHAG
GVIRIIAYVSGQPTPDITWSRDGSALPPEAKVETTFISSALIIKPCSRKHLGVYTLTAKN
AGGEKKKNVTVEVLDVPGPVGIPFTTENLSNDSCKLNWFFPENDGGSPISNYIVEKREAE
RKAWTSVSFTASRTNAVAHGLTSGKSYFFRVAAENAIGIGPFVETAAEVVIREPISIPER
PEELEVHKVTKDLISVTWKPPKSDGGSEITMYILEARMIGKDKFTRLTKEKLLERKYTYD
GLREGDTYEFRVIAVNEVGPGKPSFCTKPITCKDELEPPTIELDFRDKIIIRVGESCLLQ
GRYTGKPPPSIAWYRDDEEVKADKHVMFKNTLTTMSLGLMKAQREHSGRYVVVVENSTGS
RKGICNVTVVGVPEAPEMPTVREVYATNALVLWNRPRDGGKPITNYILEKKETMAKRWSR
ATREPLYPATQFRVQDLVEGCEYEFRVMAENELGTGDPSEPSKPILAKDPIVCPSPPVTP
EAYDKTKDSVSLKWKLPRHDGKGRIFGYLVEYKKPGAVEWIQANESPEQCPNLDFVVTGL
NDGQEYVFRIFTVNAAGKSDPAYIREPIKVHDRLEKPELLLDANMARDHLAMLGTDITLS
ATLKGVPTPVVSWKKNNDKPSPPRNLVVSEVTSESAYLTWKAPEDNGGAVISHYVVEKKD
VAAEQWVPVSAANKKLSLMAMYLMEGIQYLFRVAAENQFGRSDFIVTKTPVKAVDPLYPP
GPPKNLHHTDADKTEVWLAWEWPDRTVPPTIEVDVKLIEGVIAKAGTTIVLPAKMTGIPI
PTAKWMTDGKDITSEGRCHIETAGSSTILSISECQRGDTGEYVLIVTNPAGSKTVALHVT
VLDLPGPPVGPINILEVTPDYMMIQWRAPKDDGGTPITNYVVEKKDVKKPWEPWSVVSSS
GTNTKAKVSRLEKGREYVVRVRAENKIGISTGLESPPTIAKHMFNPPGPPGLPVCSDITE
NAVTVEWTLPDYDGGSPISGYVIERREMTGKWIRVNKTPVLDLRYRVSGLFEGNSYEFRV
FAENIAGISDPSLASDPVKAARAITRPGPPGNPKLRDWSKSYADICWTKPTRDGGSPVLG
YVVEAQKSGSAQWDRINKDLIKICAYRVPGLIEGMEYRFRIRAANKVGESEPRELAETVL
AKDILVPPEVTVDVSCRDALTIRADQILNLIYEKKPKSSEEWERLHKGAIKETYFMADRC
IENQIYQFRVQTKNEGGESNWVTTAEVLVKEQIVEPEVKIKLDGTFVVKAGDSIPIEAMV
KGKPQPDVKWTKDNSTEEIKKGPRVQIENGTDFSKLLLTGARRTDSGKYVIAVTNSAGSC
SAFATVSVLDRPGPVQDLKVSGISIDRCHLAWEAPEDNGGCDIYNYIIEKCETKRGVWSV
HSNAVITNKTKVTRLIEGNEYIFRVRAENKMGPGPAVQSEPIVAGTQFSVPYAPEMPEVT
KIAKEEMTVQWSEPEKDGGKPITGYLLEKREEHAVRWSPVNKDPTPATHFTVTGLIPLHD
YQYRVKAVNEIGISSPSKSSRAVTAKDAVGPPAPPSNLRVLDSTKSTVTLGWTKPVSTGG
APIIGYVVEMRPQGSAKKGDDGWKRCNVAAQLVVCDFTVTSLDDQLVYEFRVSAQNQVGM
SLPCDLKDAVIPKEILEAPEIDLDAMLKQGLTVRATCPIRLCATVRGRPPPKVTWRRMGI
DNVVRKGKVDIIDTMTFLLVPDSTRDDSGKYCLTVQSLAGEKAVFVNVKVLDTPGPVMNL
EATDIKQTSAMLSWTPPENDGGSEILHYIVEKREIDRKPDPCEKIEVLEITKNSATVGWI
KPARDGGAKIDGYVIEYIEVHEGEEPPPPPPQPPVVEDEEDLEPEKEVWNTYTTVKDLKV
SVSGLKESKRYKFRVAAKNLMGLSLFTETREPVEIKEQMLEPTILMPESVSARAGAKLRV
EAVVAGKPAPMCKWMRGEDAVVPSSRLAVHQSGNLCVLIIKDVSRTDSGEYSLVAENSSS
KVTQALKIVIRDIPGPPEGPVEISDIDSDACSLSWNKPLEDGGSNITNYVVEKCDVSRGD
WVTAVSSVSKTSCRLGKLIPGKEYVFRIRAENRFGLSDPIQSDRMVAKFPFGEPLNCCIS
KTNKDCMFVAWDKPSGDGGSPITGYYIERKERNSLFFVKANDTIVRTTQYPCAGLIKGLE
YTFKVSAINRACQSKPSANTYFVTARTPVYTPGKPEVLDITKNSVTLVWTRPKNDGGSKI
IGYYVEAMRVPGDSWIRCNTSSQNVPKEEYTVTGLERDLHYQFRVIAKTAVNISKPSEPT
DPVLVCAENVPPRLDLNVRMQKGLKVKAGATVILEAEVFGKPMPRVTWKRGDNSLKSCEG
QVITHQRHHFQLEMTAVTKEHTGVYTILAENATPPGPIVNPSVTDTTYSTISLAWTAPAN
DGGSPVIGYLVECKRANTADWIRCNIPRNLQETSYVIQNLIDKNEYQCRITAVNRVGFSE
PVEVPGKHVAKDIIVAPEAVLSAELKEGLELNAGATMRLEATIKGRPRPKITWAKMNTNI
KDRQGIVIKSSNTDTIVMVENVNRYDAGKYIFNLESLAGMKMYTIVVKVYDTPGPPVNLM
VKETSKDGASIFWDSPLTDGGYEVTHYIVEKRDTERKAWSIVSMNCNKTSFEVPDLNAGR
SYCFRVSGVNKLGAGEYCETADSVRASEEPGAVMDFKTVLVTKDSCTISWKKPLSDGGSR
IISYVLEVLNGDDKYKELMRSKNMQYSAKDLVEGKEYTYRVKAINDSGEGAAKELTVVAK
DQIIHPNCDLRELPNMCYIAKEGSTVRLKIPISGKPIPKVSWKKGDDEDLKDSGRVCAES
SSVNTTLLIRDCQRNDASKYTITLRNSAGIKESTIFIRVVGKPGIPVGPIKFKDVTADGA
TLKWGAPKDDGGSDIANYILEKRDSVTNMWVTVSSSVETNSMRVTGLHEGTEYIFRVCAE
NKYGVGEGLKSDPIIAKHPFNVPEAPPPPQIMNMQHNSAYLAWLDPRKTGGSPITGYHLE
FKERNSMLWKRASPTPLRMKEQSVTGLTEGLEYEFRVMAINLAGIGKPSAPTDPRVALDP
IDVPGKPEVISITKSTVTLQWIEPQFDGGHRLTGYIIEKRDLPSKIWMKANNVNVLEPAF
TVMDLQEGCKYEFRIRAKNAAGAISPASEQTDTIICRDEYAAPTIVIDAQVKEGLTVRAG
DTIVITATSILGKPTPTSCWSKGGKYFKASDLVQIETTPTSSTLSIKYATRKDTGEYVIT
ASNPFGVKEETVKVTVLDVPDSPGPIECSGISSEKVALSWTAPTENGGSPIKYYTLEKRE
TSRLLWTVLEEKVVDCHYVAYKLIQGNEYFFRVSAVNQYGASEPSHSEAVKMVDRFGPPG
PPSKPEVEKVDGHSATVTWRRPADDGGSDIIGYCVEKKEKKGTRWVRASKKSIAELAFQV
TGLAEDIEYEFRVFAENRAGFGEPSEPSMPVRTIAVAFPPGPPVNPRITDTTKTTATLNW
GKPLDNGGLDITGYMIEHKKEGTEDWLKDTLSPHRITEFVVAELETGAKYHFRISAVNSK
GAGEPAETSELVEIIERASEPDLELDVELRRTLVVRACCSIRLFVPIKGRPTPTVTWTKE
GGPVPRSSH
NT seq 28110 nt NT seq  +upstreamnt  +downstreamnt
gaatccgcccaggccccaaagtttgatgttccattggaaccagtcactgtgaacgagggt
gagaagctgagcctgaaatgccacgtgattggttctcctccactgaaggtccagtggatg
aaggacaggagggagctgaagtctagtagagaaacacaaatcacatttgttgatggaagc
gtttgtctggaggtcgaagcagcctcaaagacagaagcgggagattacctgtgcaaggct
agcaatgctgctggcagcaccttctgcaagtccagagtctcagtcaaagagaaagaattc
agagctgttcctgctgaggctgtggtgccagccatttccacgcccgtcagaagattggac
aacctgttcttcatcgaagaacctaaaaacatctctgccacagagaagggaactgcaact
tttattgccaagattggaggagagcccatccctaatgtgaagtggatgaagggtaaatgg
aggcagatcacccctggtggccgtatctccatccaccacaaaggccaggatgccaagatg
gagatcagagaagtgacaaagtccgactcgggcacctacagatgcgtggcctccaacaaa
cacggagagattgagtgtagtgctgagatggaggtcaccaaaaagcaggaagtaggagaa
tttggagatgttagagtgatgttgaagaagactccctcaaagcaaaagagtcccaagaaa
gaagagtggaatattgtggagttgctgagaggacatgatcccaaagagtatgagaagatc
ctgcaggaacacgacatccacgactaccgtgctattttacaggccatggatttgctaaag
aaggaaaaagaggctgaaccttcaaaaacggttgaccaggtggaccgagttgaggaggag
gacatggctcgtttcatccagcagctggaaagtcacattgccgcagagcctgtatcagtg
ctggaggacatcactgaccagaagacggctgagaaccagagcgccaccttcaggtgtcgc
attcagatcaactacccagagatttccctcacctggtacaaaggaacccggaggctggag
cagggccacaagtacgagatatccagcgtgggtgacctccactgcctgaaggtcaacgac
tgtgaccccagcgacgagggcgactaccgcgtggtgtgtggccctcacatctccaccgcc
atgctggctgttgcaggcaagtgtccagatctgctgttttcctgctgtgttggatcagat
ttaggagaaatcagcagaactgagttagggaaggttcctcacgaagagagaagttctgct
gatgagcacattgagaagatgcaggtgaagaagcagtctgaagagaaaactgcagcatct
ttacaaacagcacaagacaagggaccagtttctgcaccaggaccaactaaagatgggaaa
ccagctgaggaaccaccaaaaggccgaggacgaggatttggagtaagacaaaccccctca
cctggtgatggtggcaggggccggggcctgaggcccggcggtaaggggccatcgccacca
gaggaaccttttggagggtttaagctaaaggccgtcccgttaaagttcgtcaagaagctc
caggacattgtgttgcaggaggcagagtccatcggctcctctgccgtctttgaatgtcag
atctctccatccaccgccatcacttcctggatgaaagatggcgggaacctgcgtgagggg
cccaagtataagtttacagcagacggcaaagatcggaaactgaacattcttgatgttcag
ctgtcagatacaggtgaatacacctgcgtggccaggaatgctggaaaggagatcacatgc
acggccaagctgatagttgaagagctgcccgttaaatgggtgaaagagctggaaccagaa
accacgtgtatgaagggtcagcccatgtacctgacatgtgagctgaacaaagagcgggac
gtcacttggaagaggaacggcgccgtcctaaagaagaaggctggaaaagtggctattaat
atcattggtctgcagcatgctgtgaccatccagaatgctactgaggaggacactggcgcc
tatacctgtgaggtagagggacgagaagacatcagcactacaaccaacgtgaaagtgctc
gaaatcatcaaagactggctggtgaagcctctgagggaccagcatgtcaaaccaaagtct
aaggccacattcaagggggagctgttcaaggacacccccaactggaagtggttaaaagga
gagactgagattactccttctgagaagatggaaatcgccaaagatggagccaacgtgacg
ctcactatcaacaactgccagcctgacgatgtctccgaatacacgattgaagtagaagat
cgcagatacactgcaaagctaacacttggaggtgcagtcagaagacgtttccaagaacgt
gaggccgagatcctgaaacctctggccagcctagaagtggttgagaaagaagaagccaac
tttgataccgaaatttctgaggaagacatcattggcgagtggaagctgaggggtcaggtg
ttgaccaggtctccgacttgtgacataaaattggagggaaggaaacgcttcctcacactg
aaaaatgtacaagtggatcaggctggtgaagtgtcgtaccaggccctgaacgccgtcacc
acgggcatgctgactgtcaaagaactggaaatgggatttgttgatcccttaaaggatgtt
tctgtgcctgaaaagaaacaggctaagtttgagtgcactgttaccaaagaagtgccaaag
gtcatgtggttcaagggggcagaaattgtcaccccaggcccaaagtacgaaatcattgat
gatggcctgaaacacatgctggtcataaacagctgtgagtttgacgatgaggctcagtac
accatcgaggtgctggggcagagaagcagcagccagctgagggtggaaggcatcaggctg
aactttgtgcagccgctgcaggaccaaacagtgaaagaaggtaaaacagctcactttgag
ctggagctgacgcacgacaacgtgcccgtgttgtggtaccgaaacgaagttaaactgcac
gtcagccgaacagtgctcatgcacgtggagggaaagaagcacaggctagaaatgaggacg
gtgtctttagatgatacctgccagattaaagcagaagccaaaggaatttactcagtggcc
cagctgactgtcgtagagggtgacgccgtctttgtggtgaagctgcaggactttgcagcc
actgagaaggatgagctcctcctgagctgtgagctgagcaaggatgttcccgttgtctgg
taccacagtgagaaggaaatcaccgcatccaagacagtggtgctgaagtctgagggaacg
tgcaggtctctgctcctgaagagagtggagcagagcagtaaaggaacgtacacgtgtgac
tgtggaacagacaaaacctcagccgtcgtcgatgtccaagcacgtgatgttaaaatagtc
cgaccgctctacggagtggagctcttcgacggagagactgctcgttttgaggtggagatc
tccgaggatgacgtccgtggccaatggaagctgaatggagatgttcttagtcggtccccg
gatgttgacatcattgaggatggcagcaaacacacgctcatcctgtacaactgcagagtg
gcaatggcgggggaggtggcctacacggctgccaacgccaaatgctctgccaagctgaag
gtcaaagaacttccgttgaacttcctcacgtccctgaatgatgttcaggtctacgagaag
gatgaggcccggtttgaagtggagttgtcaagaccaccaaagagcttccggtggctgaaa
ggttctcaggagctgcaaagcgacgagaaatacgagctgatccaggaaggacacacttat
gtgctgctgatccgctcagctatctatgaagatgaagcaaagtacatgtttgaggctgag
gacaagaggacagcctgcaaactcatcctccaaggttcaaaaaaccaaaagcagaagaag
tttgagatgtgcagcatttccctgtttcttaatcaccatgaaagagtggtgggattccag
aatctcatctgtccgacttttcttgtggcaggaattcgtttggagtttgtcaaaccgatt
aaagacgtgacggtgaaggagcgtgaaactgccgagttcagtgtggagctctcccatgag
aacatctcagtggtctggtacaagaacgacatccgtctgcatcccagcaaggtcatccat
atgtccgaccacggcaagatccacacgctggccttcaaggaagtctccattgacgacacg
tctatgatcaaagtggaggccatggacaagaccgtgactgccatgcttaccgtcatcgag
ggggacctctacttcaccaccaagctgcagaattacacggctgtagagaaggacgaggtg
aaactgaggtgcgagctgagcaaggccattggcgatgtcaagtggttcaaggacggaaaa
gagttgactccttccaagaacatcgccatcatcaccgatggcaaaaaacggattctgacg
gtcaggaaggcagagaaggccaacatcggggagtacacgtgtgactgcggctctgataaa
actactgccaaactcaacattgaagaacgggacattaaaattgtccgtccactgtacagc
gtggaggtcacagagacggaaacagccaagtttgagacagagatttctgaggatgatgtt
catggaaactggaaactgaagggcgaagctctgcagcagtctgccgatgttgagatgaaa
gaagaaggaacgcggcacatgctcgtcctctacaacgtgcacatggacatggcaggagcc
gttgacttctctgcagccaacgccagatccagcgctcagctgcgtgtgaaagcccggtct
gtcggactggtgcgccctctaaaggacgtgatggtgacagcaggagagacggcgaccttt
gagtgtgagctgtcgtatgaaggaatcgttgtagaatggttcctgggaggacagaagatg
gaggctggtgaacgggtgaaaactcgcgtggccggtcgagcccacgctctcaccatcaga
gacgtgaatctatcagaggcgggcgaggtcaaactcactgctaaagacttccagactcag
gctcatctcatagtcaaagagcctccggtcgagtttacgaagcctctggaggaccagacc
gtggaggaggactctaccgtcaccttagaatgtgcagtgtccagagagaatgctgaagtt
cgttggttcagagatggacaggagctcagaaagacaaagaagtttgatcttctaagcttg
ggctgcaaaagaatgttagtcatccacaactgttcttcagaagacataaaaatgtataca
tgcgacaccaaagatttcaagacttcctgctacctggatgttacaccgcctcatgtggag
ttcaccaagctgctgcaggatgtggaggtcagagagagagaagctgccaagttcgaatgt
gaagtttcgcgtgagtcggccaaggttcgctggtttaaggatggcagtgagatcaggaag
ggaaagaagtatgaaatcactgccagcggtgtccagaggactttgatcattcataagagc
gggtttgacgatgaggctgagtacgaatgtgatgccaggacctccaagacctccggcctg
ctcaccgtcatcgaggaggcccccaagttcaccaagaatctttcgaatgtggaaggaatg
gagacggacagtgtgaagatgatctgtgaggtgtcgaaggccagtgctgaggtcacttgg
tatcgtggtgaggaggaactcccggaggttggccgatatgagcaaatcatggatggacgt
aagaggatcctgatcatcaagggcctcaggatggaggatgctgggcagtacacctgcagg
ctcagccccaacataaagacatcagctgtgcttcagctcaacgaacttgcagctgagttc
atctccagaccacagaaccaggaggtggtggaaggtcaggcagctgagttcacctgctct
gtctccaaagaaacctatgaggtcaaatggtttcgtggggataaggaactggaaaacgga
gacaagtttgtcatagtgagcgagggaaaaagacgagtgctcactgtgaaaaactgtgag
ctgaaggatgaaggtggttatgtcgctcacatcggcgccatcaaagcctcggctgacttg
cttgtgactgaaaagctgagggtcatcacacccattaaagacacagaggtgaaggaagga
agtgaaattgtgttcaactgtgaggccaatgcagaaggagccaaggccaagtggctgaag
aatgaggagaccatctttgagaccagcaagtacatgatggctcagagggataacgtcttc
tccctgaggatcagagatgctcagaagaccgatgaggccagctacaccgtcagcttgacc
aatcagagaggagaacaggccacatgcacagcaagtgctaaagttgcagaggagaagcac
agattcttgcagccaatcgaggacatagaaactcaggagaagaaaaccatcagcttcgtt
tgtaaggtgaatcggcccgaggtgatggtgaaatggacgaaggctggccaagaagtggcg
ctcagtaaacgcatcgtctacagagctgatggcctcaaacacacattgaccatcaaggac
tgtgtgatggaggacgaaggtgagtacacagcggtggttggagaagacagatgtacagca
gacctgatggtcagcgaagccccggccgacttcacggcactgctcaaagaccagactgtg
actgagtttgaagatgctgatttcacctgcaaactgaacaaggagaaggcttcggtcaag
tggtacaagaatggcagagagatcagagaagggcccagatatcacatgcaaagggaagga
aaggtgtgcagactgatcatcaaagagtgcagacctgatgatgaatgtgaatatgcgtgc
ggcatggacgagaggaggaccagagcgaggctctttgttgaagagaccccagtagaaatc
atcagacctcctcaagatatgctggaacctccagcctctgacattgtgtttgaggtggag
ctaaacaaggacagggtggaggtgaagtggatgaggaacaacatgatcattgtccaggga
gacaagtaccagatgatcagcgaaggtaaaatccacaggctacaggtctgtgagatcaga
cctcgagaccagggagagtacaggatcgttgccaaggacaaggatgccagagccaagctg
gagctggcagcggttccgaagatcaaaaccaccgaccagaaactggtgacagatgctggg
aagcccttcatcatgcgtgtaccctacgatgcctaccctcgcgctgaggccgagtggttc
tttgaagacaccagtctgcctgtgcagaacatcgacacgtctgttgataagactgagtac
aggctgaagagccccagcaaagaggaccagggccagtacaaggtggtgatcagtaacaag
catggcgctgcagaggccttcattgtcctggacgtcatcgatgttcctggatcagtcaaa
aacctgagagtgttggatacagctgatggtgaggtcagcttggcctgggaggaacccgag
agcgatggaggaagcaagattattgcttacgtggtagagagacgtgatgtgaagcgaaag
acttgggcacttgctaccgaccgcgctgatactccggagtactgcgtcactggtctccac
aaggactcagcttaccttttcagagtctgtgcccgaaaccgagttggcagtgggcccgct
gttgtcactgaagatgccgtccaggcaaagaacaagttcgatgttccggatgctcctgag
gatgttgcagtcgagacagtaaacaagtttggtgccaccatcagctggaagccccccaag
tttgacggaggctctgaaatcacggcctatgtgatcgagctccgcgataggacatctgtg
aaatgggaggcgacactggagtgcagtccacacgacctctctgccacacttaacgacgtg
gtggagaacaaagagtacatcttccgagtccgcgctgagaacagggctggcgtgggcagg
cccagtcctgctacaaaccctgttaagatcatggatcctattgaacggccgagcccgcct
ttgaatctgaacttcagtgaccaaatcaagacggccgtcacactgacctgggaaacccct
gttagcaacggcggcagcatgatcaccggctacatcattgagaagtgtgaagacggcact
gacaagtggctacgctgcaacgccagactgtgtcctgacctctcctacagagtgtcgggc
ctcaagccgggtcagaactacttgtacagagtgtgtgctgagaacgctgctggagtgtct
gacccagtgcagcagcttggacctttgcttgctgatgaccctcacgttggcccaaccttt
gacctcagtggcttcaggaagggtctggaggtgattgttcctcagcctctcaccatccgg
gtccccatcactggataccccacccctgttgctaggtggatctttggagaaaaggagctg
aacgcagacgagcgcgtctccttggtgacaaagcctacgttcacagagctgacagtcgcg
ccgagcatgcgtccagacaaaggaacgtacactttgcaacttgagaatgacatttcctcc
gtttctggagaagttgaagtcaatgtcattgcatgccccagtgctccaaaagacttcaag
gtggctgaagtatctcgacaccatgtccacctgatgtgggaggctccagaacatgatgga
ggaagtccagtcacccactaccagattgaaaagagagaagtatcacgcaagacctgggtc
aaggtagcttctggcgttctggacctggagcacaccgtaactgacgtgattgaagctaaa
gaatacctatttagtgtgaccgcctgcaacaagtgcggacctggagaaccagcgtacatc
gatgagccagtcaacatctcctctcctgccaccgtccccgacccccccgagaacctaaag
tggcgggataagtgtgccaaaagtatcttcctgttgtgggagcctcctaagtacgatggc
ggttccccagtcaaaggttacgtcgtggacaaatgtcagcgcggtactgacaagtgggag
ccctgtggtgatcctcttcctgagctgaagttacaggtgagcggtctgcttgaaggtcag
tggtacagctacagagtcagagccttcaacaaactgggagccagccgaccttcccgagcc
accgacgacatccaggctgtggatgccagagaacctccagagatccagcttgatgtcaag
ttgttggctggtttgactgcaagagcaggaaccaagatcgagctacccgctgatgttaag
ggcaaaccagccccccgtgtaaagtggacaaaggctgacctggtcctgcgagccgatgat
cgcgtcaccattgacactcagcccgatcattccaagctttccattgccaacactacgaga
ggagacaccgccacctacattattgaggctgtcaacgtttgtggccgtgctaccgccacc
attgatgttaacattcttgataaaccgggccctccagctgcatttgacatatctgaaatc
accagtgagtcttgctgcttggcgtggaatcctccccgggatgacggcggctcgcccatt
accaactacattgtggaaagtcgacagacagacaaagaagaatggataaagctctcagct
acagtcaaacacacaacctttaaggcctgcaagctcactggaatgaaggagtacatcttc
aggattagtgctgagaaccagtttggtattggggaacctgcggaacacgtaccaatcgtt
gctaaatattcctttgaccctcctggttctccaaccagagtcactccctctgatatcact
aaggacgcagtgactctgacctggtttgagcccgatgaagatggtggcagccccattact
ggctactgggtggaaaagtttgatccagagagtgaaaaatggatcagatgcaacaaacta
cctgttaaggacacaagcttcagggttaaggggctccgtacaaagaagaagtaccgtttc
cgtgttctagctgagaacctcgctggacctggaaaagcaagttcagaaacggatcctgtc
ctcatcaaagatcccatcgatcctccctgggcccctggcaaacctgctgtcagggatgtt
ggaaagacctcagccctgttagcatggaccagacctgagcatgatggaggagcaaagatt
gaaggctatatcattgaatttcagaagactggaagtgaagaatgggtctgcatcgctgaa
aatgttcctctgacggagcaccagctgcaaggcttgaaggaaaagcaagaatactcattt
agggtcaaggctgtaaacaaagctggggagagtgagcccagcgagcccagcgaccctgtg
atctgcaaggagagactctatcctccatcaccacctcagtggctggaggttagcaacatc
accaggatcaatgctgagctgaaatggcaggttcccagcagtgatggaggttcacccata
accaactatgtggtggagaagagagatgtcaggcggaagacatggcagtctgttgacacc
acggtcaaggacctcaaatatatcgtttctcctcttaacgaaggctcgctgtatgtgttc
cgggtggctgcggagaactctgtgggaatgagcgagttctgcgagctggaggatgctgtg
cttgccaaagacactttcacaacacctggacctccttatgcactgactgtgctggaggtc
actaaaagacatgtcgagctcaaatgggaagctcccaagagtgatggagggcgacctata
actaaatatgtgattgagaagaaggaaaaactgggaactcgctggttgaaatgctgtaag
actccagacaaacagtctcagttcaaagtgacggatgtggacgaaggttctgaggttcag
ttccaggtcagagctgagaacgaggcaggagttggagatccaagtgaacccactgagatt
ctcaatattgaggatccaaccagtgctccatctcctcctctagacttgaccattcctgat
gccagcagggaacacatcaccgccacatggaagcctccagcaaaagatggtggctgtcca
atttctggctatcatgtggaggtagccgaggcccgtccagaactgaagtggctcagggtg
aacaacaggcctatcaaggagctcaagttccggatcgatgatggcatcaaaccagagaag
aaatatgtcatcagggtacgtgccatcaactctgttggcactggtgacccctctgaaatc
acagataagatcttcaccaaggaccctgactctgcccctaccctcaagttggaagctcag
gatatagttgtgattgagggtgagaaactccacttgaaagtgccctacaaagccatccca
acacccaccatggtctggcagaaggacacgctagagtgtaaagttgatgatcgcttgtcc
atgacactggaaatgaacgatgctcatctggaattgctcaagtgcacgcatgccgacgct
ggcacgtacaccatcgtcctgaagaacgctctgggaatggtgactgggaccgtcaacgtc
aaagttattggtaggacttttttcatcctgcctgtcagtagtagtgcctgtagtaaattt
gatgcttgcaaagatagtcagaagctttttggctttttggaatcaacacttcttttctgc
acgaccgctacaggtcttcctggtcagtgtaaggacatcagatccactgacatcaccaag
aactcctgccaagtcagctgggaaatgccagaggatgatggtggaagcccgattagcagt
tataccctggagcgacgggaggcttccaagaagacctacatgcctgtcctgtcaggagag
aacgttctcacccacacagtcaaagatctctatgtcaactgtgagtacttcttcagagtg
aaagctgtgaacaaggttggagctggacaatatctggagctgcgtaacccagtcatcaca
gaagaagtcaaactgcccatgtatttactcatccttaactttgacctcacagaaaaacca
gacccacctctccaggtggagacttgtgacccgacatccaagtccatcacaatcacctgg
aaagctccagacaacgatggtggttgtcccattcaaggctacattgtggagaagatcgag
aaggatggtgaccgctatgagagggtgacgccgagcctggtacccggcttctcgtttgtg
gtaacaggtctgaaagaaaacatggagtaccagttcagggtccgagctgagaacgttgct
ggagtcagtgaaccttctcgcagcacacaactgctgaaagctgccgatcccgttgacaaa
cctggtgctccgatcaactttactttcgatgaaataaggaacacctccgtcatatgcaac
tgggagcctcccgaggacgatggtggcagcgagatcctgaactacattctggagaagagg
gactacaagaaagaagaagtcggctggatcaccatcacttccacactgaagggcaacagc
ttcccagtcaccaaacttatcgaggggaaagagtatatcttcagagtcacagctgaaaac
aaatttggctgtggaccgccgtgcatctcgggcccgctgactgctaagaaccagtttgat
ccccctgatgctcccaacactcccagagtccatgaggtgacggcgagcaccgcccgcctc
tcctggcatgagccgaaagataatggaagtccaatcctgggctactggattgagaggaag
gaggtgaacagtaaacactggacaagagtgaaccgtgccctcatcaactctctggaggtc
aaggtcagcaatctgatggagggtctcacctacatattcagagtgtgtgctgagaacctg
gctgggcccgggcccttcagcgagcccagtgaccgcaccactgctatggatgctatcttg
cctcctggccctcccacaccgtggatagtggacactgggaaggactttgtcattgtggcc
tggaagcctcctctctacaacggtggaggagatatcctgggataccacgtggaaaaggtt
ttggctggggagaaggagtggacacgcagtacagagttcagatgtaaagatttgaccttt
accgtgaccgggctcattgagggagcagattattacatccgcgttgtagccatcaacgac
gctggtcccggagctcctggtgtgactgaacctgtgatggtcaaagagcctcaagaatct
cctgtggtggaatttgatgcgtctgtgaaaaaaggtgtcatcatcagagcaggagaacct
cttaagcttcctgctgtggtgactggtcggccccagcccgaagttaaatgggctaaggat
gaaggtgaaatcgataaggatcgaatgatcgttgaaacagagggcaagaacagcagtctg
tttatcaagaagaccacaaggacagatcatgggaagtacaagatatctggtacaaacagc
agtggcacaaagtcggctgagaccagagtggatattatggatgtccctggaccagtggtt
gacctgaagacagtgactgtcacaaagaagaacataacccttacatggtctgacccacat
gacaatggtggaagtgacatcattggctatgacgtgctgagaaaagatgcaaagatgaaa
cttttccgccatccaatggagactgcatcctgtaaatgcgatattcagggcctactagct
ggtgaggaatatgatttcagggttattgctcgaaataagtatggagatggagctccatcc
gacctgggacccatcctagctcaagatcctaaaggtactccatctgcacctgaaaaattg
cactacacagacagaggcaaaaccaccatcatgttggcctggcagccaccacgcactgat
ggaggcagtccaatcaggggctactatgttgaaaagatgagatctgacagcaatgagttt
gaggtggcaaaccgcaaaatcttcaccgagtgctgtggtactattgagaacctgtcagag
aaccaagagtaccagttccgtgttaaagcagtgaacgaggttggcgatggagagccatct
aaggcaatcacagcaaagatccaggatgatgaacttgctccagttattaccatcctgaag
ttcttcaagagcaacgccatcattataaaaaaggggtcagccattgacatccctgcagaa
gtgaagggacttcctctgccatcgctccagtgggtgaaggacgatgtggtcattgagacg
cctgttgaagacaaaatgataatggagacagaggagatggaccggaccactctgaggact
aaaattgcaattccagaaactgtaaggcaggacaagggcaactacaaactagtggctgaa
aactgctttggcaaagctcaacatgtcatccgtgttgagattcttgaccgcccacttcct
ccaaggaacgtggtagtttcagacatcaaagcagattcatgttacctgacatgggacgtg
ccagaggacaatggaggcagtgagatcaccaactacatcattgagcgcagagatgccagc
aagaagaagtctgactttgaggtgcagaccaccaacctcattgacagaagatatggggta
tacaaactgaacgtaaatggtgcctaccagttcaggatcaaagctgaaaacaaatatggc
atcagtgatgggtgtgattctgagaaggtccaactgagtgatccatttggtcttcctggg
cctccacgtaaccctaaaataattgctgccactgccaccacaatgactctaacatgggat
cctcctctggacaatggtggttccaccatccagggctattggctcgagaaaagggaacgt
ggtgctgtgtactggggacgtgtcaacagagctccagtcaccaaaccagcagttaaaggt
cttcagtacacagtgctgaagctgattgaaggaaccgagtaccagttcagaattgcagct
tgcaatgctgcgggagtaggaccccccagtgaggcctccgagtgccgctttgctgttgat
ccatgcaaccctcccagctctcctggagctccagaagttaaagacaagacaaagaacagc
atcactctcagctggagtccaccagacaaagatggtggcagcccagtcaaaggttacatc
atcgaggtccatgaggagggctgtcctgattggagaagggtaaaccctgctgacaagctt
cacccatccactgaactctttgtttctgacctgaaagagggcaaaaagtgtaggtttcga
atctatgctgtgaacgctgctggaaactctgagcctgcaaggacagcagagatcctgacc
caagacatcctgattgagccgacagttactctggatgtaagtgctcatgatctgctgaac
tgcagagcagattccaccatcagaattcctgccaccatcactggaagacccctccccaaa
gtcacctggacctttgatggaaccgctgagacagagaagaagaatgatctccacattctg
cctgtcgactcagaggtgaggccattcagtttgggtgaattaatataccacaatgcattt
aagtcactgacccttttcccacacgtttctttccagatccactcttctgacacgacttca
gtggtcactatccccatcagcaaactggcccatagtggtcgatacataatcaatgcagag
agtcccgcaggacacaaagtggttaaagtcagagtcactgtgctagacctgccaggacct
ccaagagacctgaaggtcagtgatgtgacaagggggacttgtcgactcacgtggaaaccc
ccacagtgtgatggaggagagagggttaagagctactttatcgagaagaaaacagttcat
ggcaaagcttggaccaaggtcaatccagcctgtgctgctcagtctttggtggttccagac
ctgaacaatgggcaagagtacctgttccgaatccgagctgagaaccggtttgggtttggt
ccgttcacacagaccatcgagagaaccaaagccagcgatccaatcaatcctcctgatcct
ccaacacggttaaagatccagaatgttcacaagggcgctgtgactttgacttggaaggct
ccaaagaatgatggtggttcaccagtcacccattacagtgtcgatctcctctgctgggat
gctagtgggactcagaaggaacactggaggaggtgtaaccgcagggatgtagaaagcacc
aggttcaaggtggaggatttgacttatggagatgagtatgagttcagagtggtagcatac
aatgaagctggacctagtcgaccttcaacaacagcaggacccatcacaatccaagaccag
agctgtgcaccctctattgagctccaagagttcatggaggttgaacagggctctgatatt
agcattattgccaaaatccggggatgtccattccccacccttacctggtacaaagctcca
cctcacaagtcagacaacaaggtggaagttcagtacgatgagcatatcaacaagatcgtg
tctgatgatagttgcacactgctgatccagcagggcaaacgtcctgacactggtctctac
acactaatggcctctaacagtcttggcaaagcctctaaggaaatgaggctcaacgttctc
ggacgacctggacctccttctgctcccattaagtttgaggagattggtgcagagagaatt
acgctctcctggctaccaccaaaggatgatggtggctctaaagtaactaactatgttatc
tggaggcgtgtagccaacagaaagtcctgggttcctgtcaccagtgagcctaaagagagg
atctggacagtggagaacctcatgactggacatgagtatgtgttccgtgttatggcccag
aacaaatatggagttggggaaccactggacagcgaacctgaggttgcccgagacctgtat
attggtcctgaggttgacttggatacctcagttaaagagaagatggtggtccatgctggc
ggtgtgatccgaatcattgcctatgtgtctggccagccgactccagacatcacctggagc
agagatgggtctgcattgcctcctgaagccaaggtggagacaactttcatcagttcagca
ctcattatcaaaccctgctccaggaagcaccttggcgtctacacattgacggccaagaat
gctggaggagagaagaagaaaaatgtcaccgtggaagtcctggatgttcccggacctgtt
ggcattcctttcactacagagaacctgagcaatgactcctgcaagctcaactggttcttc
cctgagaacgatggtggttctcctatcagtaactatattgtggaaaagcgcgaagcagag
cggaaggcctggacctcagtgtctttcactgccagtagaacaaatgctgtagctcatggg
ctgaccagtggaaagtcctacttctttagagtagcagcagagaatgccattggcattgga
ccatttgtggagacagcagctgaagttgtcatcagggaaccaattagcattcctgagcga
ccagaggagctggaggtacacaaggtcactaaggatttaatcagtgtgacatggaaacca
ccaaagtctgatggaggttcagaaatcaccatgtatattctggaggcgcgtatgatcggt
aaagacaagttcacccggctgacaaaagagaagcttttggagaggaagtatacgtacgac
ggtctaagggagggggacacctatgaattcagggttattgccgtcaatgaggttggcccc
ggcaagccatcattttgcactaaacccatcacctgtaaggatgaactcgaaccaccgacc
attgagctggatttccgtgataagattattattcgtgttggtgaaagctgcctactacaa
ggccgctacacaggcaagccccctccttcaattgcctggtacagagacgatgaggaggta
aaggctgacaaacacgttatgttcaagaatacactgaccaccatgtcacttggcctgatg
aaagctcagcgtgagcacagtggcagatatgtggtggtggtggagaacagtactggatca
cggaagggcatctgcaatgtcacagttgttggagttccagaggcccctgaaatgcccaca
gtcagagaggtgtatgccaccaatgccctggtactgtggaaccggccacgtgatggtggg
aagcccatcaccaactacatcttggaaaaaaaggagaccatggcaaagcggtggtctcga
gctacaagagaaccgttatacccggccacccagttcagggtccaggatttagtggagggc
tgtgaatatgagtttagagtgatggctgagaatgaactgggaactggtgatcccagcgaa
ccatctaaacccatccttgccaaagatcccattgtgtgtcccagtcctccggtgacacca
gaagcctatgacaagaccaaggactctgtcagcctgaagtggaagttaccacgccatgat
gggaaaggccgcatctttggctacttagttgaatacaagaagcctggtgctgtggagtgg
attcaggccaatgagtccccagagcaatgccccaaccttgactttgtggtgacaggtctg
aatgatggacaggagtatgttttcaggatctttactgtgaatgccgctggcaaatctgac
cctgcttacatcagagagcccatcaaagtccatgacagactcgagaagccagagttgttg
cttgatgccaacatggcgcgtgaccacttggcaatgctgggcaccgacatcaccctaagt
gccacacttaaaggtgtcccgactcccgtcgtcagctggaagaaaaacaatgataagcca
tctcctcccagaaacctggtggtttctgaggtgaccagcgagtctgcctacctgacgtgg
aaagctcccgaggataatggtggtgctgtcatctcgcattatgtggtagaaaagaaagat
gtggctgctgagcagtgggtgcccgtctctgctgctaataaaaagctgagtctgatggcc
atgtatttaatggagggaattcagtatctcttcagagtagctgctgaaaaccagtttggc
agaagtgactttattgtgaccaagacaccagtgaaagcagtcgatccactctatcctcct
ggcccacccaaaaacctccaccacacagatgcagacaagaccgaggtctggctggcatgg
gagtggcctgaccgcacagtaccaccaacaattgaagttgatgtaaaacttattgagggc
gtcattgccaaagctggaaccaccattgtgcttccagctaagatgacaggcattcctatt
ccaactgccaaatggatgactgatggcaaagacatcacatctgagggccgctgtcacatt
gagactgctgggtcctccaccatcctcagtatctctgaatgccagagaggagacactgga
gagtatgttctcattgtgaccaatcctgcaggcagcaagactgtagccctacatgtgact
gtcttagatcttccaggtccaccagttggacccatcaacatcttggaagtcaccccagat
tacatgatgattcaatggagagcacccaaagatgatggtggtacccccatcacgaattat
gtggttgaaaagaaagatgtgaagaagccttgggagccctggtctgttgttagttccagt
ggcaccaatacaaaggccaaagtgtccaggctggagaagggtcgtgaatatgttgttcgt
gtccgtgcggaaaacaaaattggcataagcacagggctagagagtcctccaacaattgcc
aaacatatgtttaatccacctggcccaccaggtttgccagtgtgttcagatattacagaa
aatgcagtaactgtggagtggaccctacctgattatgatggcggcagccctattagtggt
tatgtgattgaacgcagagaaatgacagggaaatggatccgtgtcaacaaaacccctgtg
ctagacctcagatacagagtctcaggtctgtttgaaggcaacagctatgagttcagggtg
tttgctgaaaacattgctggaatcagtgacccttcacttgcctctgatcctgttaaagct
gcccgtgccatcactagacctgggccacctggtaatcctaaactgagggactggagcaag
tcctatgcagatatctgctggactaagcctacaagagatggtggcagtccagtccttggc
tatgtggttgaggctcagaaatcaggaagtgcccagtgggacagaatcaacaaggaccta
attaaaatttgtgcctatagagtccctggtctcattgaaggaatggagtatagattccgc
attagagccgctaacaaggttggagagagtgagcccagagagcttgctgaaactgtgctt
gcaaaggacattcttgttccccctgaggttactgttgatgtctcttgccgagatgctctg
actatcagagcagatcagatcttgaatttgatttacgagaagaagccaaaatcctctgag
gaatgggagaggcttcataaaggagccatcaaggagacctacttcatggctgacaggtgt
attgaaaaccaaatctaccagtttagagttcagacaaagaatgaaggcggtgagagcaac
tgggtgaccacagctgaagtcctggtaaaggaacagattgtggaacctgaggtcaagatc
aagttggatggaacatttgtggtaaaagcaggagattccattcctattgaggcaatggtg
aaaggcaaaccccaaccagatgtgaaatggaccaaagataacagcactgaggagataaag
aagggtcccagggttcagattgaaaatggcacggatttctcaaagttgctacttactggt
gcaagacgcactgacagtggaaaatatgttattgctgttacaaacagtgctggctcctgc
tctgcttttgccacagtcagtgttcttgacagacctggtccagttcaggatctcaaagtg
tcaggtatcagcattgacaggtgccatttggcttgggaagccccagaggataatggcggt
tgtgacatctacaactacattattgagaaatgtgagaccaaacgaggagtatggtcagtc
cactccaacgctgtcatcactaacaagactaaagtcactcgactcattgagggtaatgaa
tatatattcagagttcgtgcagaaaacaaaatgggcccgggtcctgctgtacaaagtgag
cccatcgttgctggaacacagttcagtgtaccttatgctccggagatgccagaagtcacc
aagatagccaaagaagaaatgacagtgcagtggtctgagccagaaaaagatggtggaaag
cccatcactggctatctgttagagaagagagaagaacatgctgtgaggtggtcgcctgtc
aacaaagatcccacccctgcaactcatttcacagtcactggactaatacccctccatgat
tatcaatacagagtcaaagctgtcaatgaaattggcatcagcagtccaagcaagtcttca
cgtgctgtcaccgccaaagatgcagttggcccccctgctcctccatcaaacctgagagtc
ctggacagtaccaagtcaactgtcacactaggatggactaagcctgtgtctactggggga
gctcccattattggttatgtggttgagatgaggccacaaggaagtgccaaaaaaggagat
gatggatggaaacggtgcaatgttgcagctcagctggttgtgtgtgactttacagtcaca
agtctggatgatcagcttgtatatgaattcagagtatctgctcagaaccaggtgggcatg
agtctgccatgtgacctaaaggatgctgtgattcctaaggaaattcttgaggcaccagag
attgacttggatgccatgctgaagcagggattgacagtgagagccacctgtcccatcaga
ctttgtgccactgtgagaggaagaccacctcctaaagtaacgtggaggaggatgggcatt
gacaacgtcgtcagaaagggaaaagttgatatcattgacacaatgaccttcctgcttgtc
cctgatagtactcgcgatgactctggaaaatactgcttaactgtacagagtctggctgga
gaaaaggcagtatttgtcaatgttaaggttctagatactccaggacctgtgatgaatctg
gaagctactgacatcaagcagacctctgctatgctgtcatggactccgccagaaaatgat
ggtggcagcgaaatccttcactacattgttgagaaacgcgagattgatcgtaaacctgat
ccctgtgagaaaattgaggttttggagatcacaaagaacagtgcaactgttggttggatt
aaaccagcaagagatggtggtgccaaaattgatggttatgtgattgaatatattgaggtt
catgagggagaggaacctccaccacctcctccacagcctccagttgtagaggacgaagaa
gacctggaacctgagaaagaagtgtggaatacttatacaacagtaaaagatttgaaagtc
agtgttagtggcttgaaggagagcaagagatataaatttagagtggctgccaagaacctc
atgggcctaagcttgttcactgagaccagggagcctgttgaaatcaaggagcaaatgttg
gagccaacaattctcatgccagagtcagtcagtgccagagctggagccaagctcagagta
gaagcagttgtcgctggaaaacctgctccaatgtgcaagtggatgcgtggcgaggatgca
gtagtgccatctagtcgtctggctgtgcatcagtctggcaacctgtgtgtcttgattatc
aaggatgtgtcacgaactgacagtggagaatatagtctggtggctgagaacagctcttca
aaggtgacccaggctctgaagattgtcattagagacatccctggacctcctgagggccct
gtggagataagtgatattgactctgatgcctgctccctgtcctggaataaacctctggaa
gatggtggcagcaacatcactaactacgtagttgaaaagtgtgacgtcagtagaggtgac
tgggtgacggctgtctcttctgtctcaaagacgagctgcagactaggaaagctcattcct
ggcaaggaatatgtttttcgtatccgtgctgagaaccgttttggtttatcagaccccatt
cagtctgacaggatggtagctaaattcccatttggtgagccacttaattgctgtatcagc
aaaaccaacaaagattgtatgtttgtggcctgggataagcccagtggtgatggtggcagc
cccatcacaggttactacatagagcgtaaagaaaggaacagccttttttttgtaaaagcc
aatgatactatcgtgcgcaccactcaatacccatgtgctggtctcattaaaggcctcgaa
tacactttcaaagtgtctgccatcaaccgtgcttgtcaaagcaaacctagtgcaaatact
tactttgtcactgccagaacacccgtttacaccccaggtaagcctgaagtactggacatt
accaaaaactccgtgaccttagtttggactcgtcccaagaatgatggaggcagcaaaatc
attggctattatgtcgaagccatgcgagtgccaggagactcgtggatacgttgcaacacc
agcagccaaaatgtcccaaaagaggagtacacagtgacgggcctcgagagggacttgcat
tatcagtttagagtcattgccaaaactgctgttaacatcagcaaaccatctgagcccaca
gaccctgtccttgtttgtgctgagaatgttcctccaaggctagatcttaatgtcaggatg
cagaagggtctgaaggtaaaagctggggccacagtcatactagaagctgaggtgtttggt
aagccaatgccccgagtgacctggaagagaggcgacaacagcctaaagtcatgtgaaggc
caggtcatcacccatcaacggcatcacttccagctggaaatgacagcagtcaccaaagag
cacactggagtatacaccatcttggcagaaaatgccacgccccctggacccattgtaaat
cccagtgtgacagacaccacctacagcactatcagccttgcctggactgctcctgctaat
gacggtggaagccctgtcattgggtacttagtggagtgcaagagggccaacacagcagac
tggatacgctgcaacattcccaggaacttgcaggagaccagctatgtcatccagaacctc
atcgacaaaaatgagtaccagtgccgtatcactgctgtcaacagagttggcttcagtgag
ccagtggaagtacctggcaaacatgtggctaaggacataattgttgctcctgaagcagtg
cttagcgctgaactaaaggagggtttagagctaaatgctggtgccacaatgagactagag
gctaccatcaaaggccggccccgtcctaagatcacatgggcaaagatgaacaccaacatt
aaggatcggcagggtattgtcatcaagtccagcaacactgacacaatagtgatggtggag
aatgtcaacagatatgatgccggcaaatacattttcaacctggagagcctggctggcatg
aagatgtacaccatcgttgttaaggtttacgatactcctgggccaccagtcaatctgatg
gtgaaagaaacttccaaagacggtgcttccatcttctgggattctcctttgactgatggt
ggctacgaagtcactcactacattgtggagaagcgtgacacagagaggaaggcctggtcc
attgtgtccatgaactgcaacaagacatcttttgaggtgccagacctaaatgctggacgg
tcctactgttttagagtgtcaggagttaacaagcttggtgctggagaatattgcgagaca
gctgactcagtcagagcatcagaggagcccggtgctgttatggactttaagacagttttg
gttaccaaagactcctgcactatcagctggaagaaaccccttagtgatggcggcagccgc
attatctcctatgtactcgaagttcttaatggggatgataagtacaaggagttaatgaga
tccaaaaacatgcagtacagtgccaaagacctggtagagggcaaagagtacacctacaga
gtcaaagctataaatgattctggagagggtgctgccaaggagctgacagtggttgctaag
gaccagatcattcatccaaactgtgatctgagggaactacccaatatgtgctacattgca
aaggagggcagcactgtccgtctgaagataccgatcagtggcaaacccataccaaaggtc
tcatggaaaaagggagacgacgaagacttaaaagacagtggtcgcgtgtgtgcagagtct
tcttcagtcaacaccacactcctcatcagggactgccagaggaatgatgcctctaaatac
actatcaccctgaggaacagtgctggaatcaaagaatcaaccatcttcattagggtggtg
ggtaaacctggaatcccagttggacccatcaagtttaaagacgttactgctgatggagca
acgctgaagtggggagctcccaaagatgacggtggctccgacatcgcaaactacatcctt
gaaaaaagagactcagtcaccaacatgtgggttactgtgtcttcatcagtggagaccaac
tcaatgagagtcactggtcttcatgagggcacagagtacatattcagagtctgtgctgag
aacaaatatggtgttggagagggccttaagtctgatcccatcattgctaaacatccattc
aatgttcctgaagctcctcctccacctcagatcatgaacatgcagcacaactctgcttac
ttggcttggctggaccccaggaagactggaggatcaccaataacaggttatcatcttgag
ttcaaagagaggaacagtatgctgtggaaaagggcaagcccaacccccttgaggatgaag
gaacagagtgtaactgggctaactgaaggtctggagtatgaattcagagtcatggcaatt
aatctggctggcattggtaaaccaagtgctccgaccgatccacgggtggcactagatccc
attgatgtccccggtaaacctgaagtgatcagcatcaccaaaagcacagtgacccttcag
tggatcgaaccacagttcgatggcggccacaggctaactggctacatcatcgagaaacgt
gatctgccttcaaaaatctggatgaaggccaacaatgtgaatgttttggagcctgcattt
actgtcatggatctgcaggaaggctgtaaatatgaatttagaatccgggcaaagaacgct
gctggtgctatcagcccagcctctgaacagacagacaccattatctgtagagatgaatat
gctgcaccaaccattgttattgatgctcaggtaaaggaaggtctaactgtcagagctggt
gatactattgtcatcactgcaaccagcattttaggcaaacctaccccaacgtcctgctgg
tcaaagggaggaaagtactttaaagcgtctgatcttgttcagattgagaccaccccaact
tcctccactctttccattaagtatgccaccagaaaggatactggggagtacgtcatcact
gctagcaacccctttggtgtgaaagaggaaactgtcaaggtcacagttctggatgtaccg
gatagtccaggacccattgaatgcagtggcatctcctctgaaaaagtagctttaagttgg
acagctcctaccgaaaatgggggctccccgattaagtattacaccctggagaaaagagag
accagccgtctgctctggaccgtcctggaggaaaaggttgtagattgtcattatgtggcc
tacaagttgatccaaggcaacgaatacttctttagagtatctgctgtaaaccagtatggt
gccagtgagccatctcactcggaggcagtaaagatggttgatagatttggtcctcctgga
ccaccatctaaacccgaggtggagaaagttgatggacattcagccacggtaacctggaga
aggccagcagatgacggtggaagtgatatcataggttattgtgttgagaagaaggaaaaa
aaaggaacaagatgggtcagggcatccaagaagtcaatcgccgaacttgcatttcaagtt
acaggtctcgctgaggacattgaatacgagttccgtgtttttgctgagaacagagctggc
tttggggagcccagtgagccatcgatgcctgttagaacaattgctgttgcctttcctcct
ggaccaccagttaatccaagaatcacagatacaaccaagaccactgccaccttaaactgg
ggaaagcctcttgataatggtggtctagatattactggatatatgattgagcacaagaaa
gaaggaacagaagattggcttaaggataccctatcaccgcataggattacagagtttgtt
gttgctgaactggaaacaggtgcaaaatatcatttcagaattagtgcggtaaattctaaa
ggagcaggtgaacctgcagaaactagtgaactggtcgagattatagagagggcatctgaa
ccggatctggagctggatgttgagctgagaagaactcttgttgttagggcttgttgttcc
attcgtctctttgtcccaatcaagggtcgtcctacacccaccgtcacctggaccaaggaa
ggtggccctgttccaagaagcagtcactga

DBGET integrated database retrieval system