KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00009727G001Help
Entry
GSTEN00009727G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K09568  FK506-binding protein 1 [EC:5.2.1.8]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:tng03110]
    GSTEN00009727G001
Enzymes [BR:tng01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     GSTEN00009727G001
Chaperones and folding catalysts [BR:tng03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    GSTEN00009727G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-ProteinID: CAF93877
UniProt: Q4SZQ5
Position
undetermined
AA seq 109 aa AA seqDB search
MGVEVETIVPGDGQTFPKKGQRVVVHYVGTLMNGQMFDSSRDRGKPFKFKIGHGEVIRGW
EEGVAQMSVGQRAKLICSPDFAYGSKGHPGIIPPNATLIFDVELLGLEV
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggagtggaggttgaaaccattgtccccggagatgggcagactttcccgaagaagggc
cagcgcgtcgtggtgcactatgtcggcacactgatgaacggccaaatgttcgactcgtcg
agggacagagggaagccgtttaaattcaagattggacacggagaggtgatccgcggttgg
gaggaaggagtagcccaaatgagcgtgggtcagcgggcaaagctaatttgctccccagac
tttgcctacggctccaaaggacacccgggcatcatcccaccaaacgccaccctcatcttc
gacgtggagctgctcggcctggaagtc

DBGET integrated database retrieval system