KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00009957G001
Entry
GSTEN00009957G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K02296  aryl hydrocarbon receptor nuclear translocator-like protein 1
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tng03000]
    GSTEN00009957G001
Transcription factors [BR:tng03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    GSTEN00009957G001
SSDB
Motif
Pfam: PAS_11 PAS PAS_3 HLH PAS_9 PAS_4 PAS_2
Other DBs
NCBI-ProteinID: CAF94040
UniProt: Q4SZ92
Position
13
AA seq 677 aa
MADQRMDISSTMTDFMSPGSTDLISSSISTPGMDYTRKRKGSTSDYHDMDPDKDKLGSNI
LKGRIICHLHSSRREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQ
HMKTLRGAANPYTEANYKPSFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVYKIL
NYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLC
SGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDE
DNEPDNEGCNLSCLVAIGRLHPHIVPQPSLADIRVKPTEYVSRHAIDGKFVFVDQRATAI
LGYLPQELLGTSFYEYFHQDDIGHLAECHRQGTRAVPPTDHVTRSNPPPPPPCLFVAHGV
AGCVSAVLQMREKINTNCYKFKIKDGSFITLRSRWFSFMNPWTKEVEYIVSTNTVVSCPM
MEGSDYPQSAVSPQSMDCVLTSEGGGRRALQTVPGIPGGTRAGAGKIGRMIAEEVMEIQR
IRGSSPSSCGSSPLNITSTPPPDTCSPGGKKIQNGGTPELPSAGIIPGPDSVGYPYSNQS
IMSESHTHRRAKHTLSLLNHPSPVQGDNSHLSIDIMDDPGSSSPSNDEAAMAVIMSLLEA
DAGLGGPVDFSDLPWPL
NT seq 2031 nt   +upstreamnt  +downstreamnt
atggcagaccaacggatggacatctcatcgacaatgaccgacttcatgtccccaggctcc
accgacctcatctctagttctatcagtacacctgggatggactacacccgcaagaggaag
ggcagcacctccgactaccatgacatggacccagacaaggataaactgggaagcaacatt
ttaaaaggaagaataatctgccaccttcactcatcccgcagagaggctcacagtcagatc
gagaagcgtcggcgggacaaaatgaacagttttatcgatgagctcgcgtctctggtgccc
acctgcaacgctatgtcccgcaagctggacaagctaacggtcctacgcatggctgtccag
cacatgaagaccctgagaggcgctgctaacccgtacactgaggccaactacaagccctcc
tttctctccgacgatgagttgaagcacttaatactgagggctgccgacgggttcctgttt
gtggttgggtgtgaccgcggaaagatcctctttgtgtctgaatcggtgtacaaaattctc
aactacagccagaacgatctgataggccagagcctttttgattacctacatcccaaggac
attgccaaggtcaaagagcagctgtcgtcttcagatacagccccgcgagagaggctcatt
gacgctaagaccggccttccagtgaagacagacatcacccccggtccgtccagactgtgc
tccggtgccaggcgctcatttttctgcaggatgaagtgcaatcggccttctgtgaaagtg
gaggacaaggacttcccgtccacctgctcaaagaaaaaagccgaccgcaagagcttctgc
acgatccacagcacgggctacctgaagagttggccgcctaccaaaatgggcctggacgag
gacaacgagcccgacaacgaaggctgcaacctgagctgcctggtggccatcggccgtttg
cacccccacatcgtcccccaacccagcctggccgacatcagagtgaagcccaccgagtac
gtctccagacacgccatcgatggcaaattcgtctttgttgaccagagagcgacggccatt
ctgggctacctgcctcaggagctgctgggaacttccttttacgagtatttccaccaggat
gatatcggccacctggccgagtgtcacagacaaggtacccgcgcggttcccccaacagat
cacgtgacgcgctcaaaccccccccccccccccccctgcctgtttgtcgctcacggcgtc
gccgggtgtgtgtccgcagtgctgcagatgagggagaagatcaacaccaactgttacaag
ttcaaaatcaaggacggctccttcatcactctgaggagtcgatggttcagtttcatgaac
ccctggaccaaggaggtggagtacatcgtttccaccaacaccgttgtctcgtgtcctatg
atggaagggtcggactacccccaatctgctgtttcaccacagagcatggactgtgttctc
acctcagaaggtggaggaaggcgggcgctgcagacggtgccgggcatccccggaggtaca
agagccggagctgggaaaattggacgcatgatcgcagaggaggtgatggagatccagagg
atccgaggctcctccccctccagctgtggctccagcccgctgaacatcaccagcacccct
ccgcccgacacctgctctccaggcggcaaaaagatccaaaatggaggcacgcccgagctc
ccaagcgcggggatcattcccggaccagactccgtaggctacccttactccaaccagtcc
atcatgagtgagtcgcacacacaccgacgcgctaaacacactctatcccttctaaaccac
ccgtctcccgtccaaggtgacaactcccacctgagcatagacatcatggacgaccccggc
tccagcagccccagcaacgacgaggcggccatggcggtcatcatgtccctgctggaagcg
gacgccgggctgggggggcccgttgacttcagtgacctaccctggcctttg

DBGET integrated database retrieval system