KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00010632G001Help
Entry
GSTEN00010632G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00071  Fatty acid degradation
tng01212  Fatty acid metabolism
tng03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GSTEN00010632G001
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    GSTEN00010632G001
Enzymes [BR:tng01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     GSTEN00010632G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-ProteinID: CAF94509
UniProt: Q4SXX3
Position
undetermined
AA seq 656 aa AA seqDB search
MAKLLSLCYTAPLRKPGKFLLRNAAPNVYGLNYGSKRSSSDDYLQRSLVPTMHYQKSLPR
LPIPKLEDTMRRFLAAQRPLLSDDQFRTTEKIAQDFLNGVGRELHKELVTRDKLNNHTSY
ISGPWLDMYLKNRKSLLDMNAFTLFHQDPKTEYNQQLVRATNLTCSALRFMKTLRAGLLE
PTVFYSEPSKSNRHLFERVIRWVPPSLSWYGAHMVNAYPLDMSQYYRIFNSTRIPRRGRD
ELVTHEEGRHIVVMRKGNMYVFDVVDRDGNLLKPAEIQAHLKYILDDLTPAPAFPIGVLS
TENRDVWAHLRDKLVHCGNADNLRTIESAVFCLCLDDAVPENQENLWLMGNSCNRWLDKS
FNFCISTSGEFSAFSEHSWGDGLIGSLALGGIHKDSTERPQVHPASAAAAVDSAAAVRLL
KFNLDSELKEGIKKAKDNISLAESQPGVEFMEFRKGGKETLKKYKISSDSMVQLAIQMGF
LRLYGQTVPTSESCSTAGFKHGRYEVMMPVNMYTKECAHAFVCQRDQHTTQQLKAMLHQC
SDHHRQLIREASAGQGFFCHLYCLYDLSTSKDQELHSLFTDCGILNGFTLSTSTVSAPSL
KTFVFAPDVPEGFGVFYTFHDNTIFFSLSSFLPRSRQELSQSIFKSLEDIFTVLEE
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggccaagctgctgtctttgtgctacacagcaccactgaggaaacctgggaaatttctt
ttaagaaatgctgctccgaatgtttatggactaaactatgggagcaaaaggtcatcttca
gatgactatttgcaaaggagtcttgtgccaacaatgcattaccagaaaagtttgcccagg
cttcctataccaaaactcgaggacaccatgaggaggtttctagctgcccaaaggcctttg
ttgagtgatgaccaattcagaacaacggagaaaatcgcccaggacttcctgaatggtgtc
ggcagagagttacacaaggaactggtgactcgggataaactcaacaaccacaccagctac
atttcagggccttggttagacatgtatcttaaaaatcgcaaatctttgctggacatgaat
gcttttacactgtttcatcaagacccgaagacagagtacaatcaacagctggtgagggcc
accaatctgacgtgctcagctttgcgcttcatgaaaacgctgagagctggactgctggag
ccgacggttttttactccgagccatcaaagagcaaccgacacctctttgaaagggttatc
cgctgggttccgccctctctgtcctggtacggagcccatatggtcaacgcctaccccctg
gacatgtctcagtactaccgcatcttcaactcaactcggattccaagacggggccgagat
gagctcgtcacccacgaggaaggccgccatattgttgtcatgaggaaagggaacatgtat
gtctttgatgttgtagacagggatggcaatttgctgaagcctgcagagatacaggcccac
ctgaagtatattttggatgacctgaccccagcacctgcctttcccatcggagtcttgagc
acggagaaccgagacgtgtgggcccacctgagagacaaactggtccactgtggaaatgca
gacaacctgaggactatagaaagtgccgttttctgtctgtgtctggatgatgcagttccg
gagaaccaagaaaacttgtggctgatgggcaacagctgcaacaggtggcttgataagtct
ttcaatttttgtatttcaacatcaggagaatttagcgctttttctgaacactcctggggc
gacggtttaattgggtcgcttgctctagggggaatccacaaagactccacagagcggcca
caagtacacccagcatctgccgctgctgctgtggattctgccgctgccgtgcgtctgttg
aagtttaacctggacagtgagctgaaggagggcatcaagaaagccaaggacaatatcagt
ttagctgaatcgcaacccggtgtcgagtttatggaatttaggaaaggtggaaaggaaaca
ttaaagaagtataaaataagttcagactctatggtccagcttgctatccagatgggcttc
ctgaggctgtacggacaaaccgtacccacatctgagtcctgcagcacggcgggattcaag
cacggtcgttacgaagttatgatgccagtcaacatgtacaccaaagagtgtgctcacgcc
tttgtttgccaacgggaccaacacaccacacagcagctgaaggccatgttgcaccagtgc
tccgaccatcacaggcagctaatcagagaagcatctgcaggccaaggtttcttctgtcat
ctatattgcctgtatgacctgtcaacttccaaggaccaggaattgcacagcctgtttaca
gattgtggtatcctaaatggctttaccctgtctaccagcacagtctctgccccatccctt
aaaacattcgtctttgctccagacgtgcctgaggggtttggtgttttctatacttttcat
gacaacaccatattcttcagcttgagcagcttcctgcctcgcagccgccaggaactcagt
caaagcattttcaaatctttagaagacatttttactgtcctggaagaa

DBGET integrated database retrieval system