KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00011672G001Help
Entry
GSTEN00011672G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00230  Purine metabolism
tng01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GSTEN00011672G001
Enzymes [BR:tng01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     GSTEN00011672G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HNOBA HNOB Guanylate_cyc
Motif
Other DBs
NCBI-ProteinID: CAF95144
UniProt: Q4SW38
Position
undetermined
AA seq 860 aa AA seqDB search
MDGHRCNPPPVETRKGALKKQHQHLATAASAATRHRRLPPPAKVSTFWSSDRVEMSEVPK
QAAHPTAAGEGSFHSSGLSAAEGVTMYGLYLEAVNDYINESYGEDVWRLIENRAEIPHLK
FVRHQMYNDNLILRLAKAAGEVLGKTHDELMYAFGVYMVKRIGNYGYERILKVLGRNVRD
FINELDNLHEYFRFSFPKVQPPSFCVEEECETSLTLHYRSTRKGFTQFVKGGNSGQLSQV
GRQFYNTDIEVEILSKEETEKMTYVVRRCCAPTCPAAGGHLTPAPPCHGFRLAQVYKMNF
DNAAFKHRMPQQKTAPSYEKLPMKRGIFFDMFPFSVIFRRDMTMYRIGDGLKEVFSDLQG
KKVNEEFTLVRPMLEFSWDNIYTHLNNVFELLSKAVVESKQKVNIPKLSKEEPEEKEESE
KAKREEERGGAPAFLPPGRNWQAEPGCSDGRLSPLEPKTVEEMKGTDQEYSSALTQYNSS
ANSGGEDIELLAFQTVTGQRRRRPSTMGGRCSRSALNRVLLSSGKCSETIFEDMREPPKK
PLHLKGQMKYVPQWDSLIFLGTPIIETVEDMIKMGVYVNDLNLHDSSRELILAGTQQSAE
LQLALDQEQQKYAQLQEIIKKLDEEKKRGDSLLYAMIPKAVADRLRKGITALETCQVFPD
VTILFSDVVKFNEICIHITPMQVVDMLNEIYIVFDTLSEKHNVYKVGPAGARPQPRPRPH
LTSMLDSAQVETIRDAYMVVAGVPNKTTFHAHHICDMALDMLSSIDHLKDPSTGDNIQIR
VGEDRPGGRFQIFLEVAAMTRRVHQGSLLASPSRDPLGDGGGRRGGPEDASLLSVRGHRQ
HSVTDGEQWSGVYTYIYRHA
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atggacggtcaccgttgtaaccctccaccagtagaaactaggaaaggtgccctgaaaaag
cagcaccagcacctggcaacagctgcttcagcagccacacggcaccgacgactcccccct
cccgccaaagtctctaccttttggtcctcagacagagtggagatgtcagaggtgcccaaa
caggcggcgcatccaaccgctgctggagagggctcttttcactcatccggactctccgca
gctgaaggcgtcaccatgtacggcctgtacctggaagcggtcaacgactacatcaacgag
tcctacggcgaggacgtgtggcggctcatcgagaaccgcgcagagatcccccacctcaag
tttgtccggcaccagatgtacaacgataacctgattctgcggttggcgaaggcggcgggc
gaagtcctgggaaagacccacgatgagctgatgtacgccttcggggtctacatggtcaaa
cgcatcggaaactacggatacgagcggatcctgaaggtcctgggacgaaacgtgcgtgac
ttcatcaacgagctggacaacctgcacgagtacttccgcttctccttcccgaaggtgcag
ccgcccagcttctgcgtggaggaggagtgcgagaccagcctgacgctgcactaccgcagc
acccgcaagggcttcacccaattcgtcaaaggtgggaactcagggcagctctcccaggtg
gggcggcagttctacaacaccgacatcgaggtggagatcctgtctaaagaggagacggag
aaaatgacctatgtggtacgtaggtgctgcgcccccacctgcccagcggctggtggtcac
ctgacccccgccccaccgtgtcacgggtttcgtctcgcccaggtttacaagatgaacttc
gacaacgccgccttcaaacaccgcatgccccagcagaagacggcgcccagctacgagaag
ctgcccatgaagcgcggcatcttctttgacatgttccccttcagcgtcatcttccgccgc
gacatgaccatgtaccgcatcggcgacggcctcaaggaggtcttctcggacctccagggc
aagaaggtcaacgaggagttcaccctggtcaggcccatgctggagttcagctgggacaac
atctacactcacctgaacaacgtgtttgagctgctgtccaaggcggtggtggagagcaag
cagaaggtcaacatccccaaactgagcaaggaggagcccgaggagaaggaggagagcgag
aaggccaagcgggaagaagaaagaggtggcgctccggcgttcctgccgccgggcagaaac
tggcaagcggagcccggctgctctgacggccgtctgtctcccttagagccgaagacggtg
gaggagatgaagggaacggaccaggagtacagcagcgctctgacccagtacaacagctcg
gccaactccggaggggaggacatcgagctgctggccttccagaccgtcaccggtcagagg
cgccgacgcccgagcaccatgggggggcgctgcagccgctctgccctcaaccgtgtcctt
ctgtcctcagggaagtgcagcgagaccatcttcgaggacatgcgggagcctccaaagaag
ccgctgcacctgaagggacagatgaaatacgtcccccagtgggactcgctcatcttcctg
gggacccctatcatcgagacggtggaggacatgataaagatgggcgtgtacgtgaacgac
ctgaacctccacgactccagcagagagctgatcctggctggaacgcagcagtcggccgag
ctgcagctcgccctcgatcaggagcaacagaaatacgctcagctgcaggagatcatcaaa
aagctggatgaggagaagaagaggggggactctctgctgtacgccatgatccccaaagct
gtggccgaccgcctgaggaagggcatcaccgctctggagacctgccaggtgttccccgac
gtgaccatcctgttcagcgacgtggtcaagttcaacgagatctgcatccacatcacgccc
atgcaggtggtggacatgctcaatgagatctacatcgtcttcgacacgctcagcgagaag
cacaacgtctacaaggtgggacccgccggggcgcggccgcagccccgcccccggccccac
ctgacctcaatgctggactctgctcaggtggagaccattcgtgatgcctacatggtggtg
gcgggggttcccaacaaaaccaccttccatgcgcaccacatctgtgacatggcgctggac
atgctgagctccatcgaccacctgaaggacccctccaccggggacaacatccagatcaga
gtcggtgaggacagacctggcgggcgtttccagatttttctagaggtggctgcaatgacg
cgccgcgtccaccaggggtcactgttggcttccccctccagggatccactcggggatggt
ggtggccggcgtggtgggcctgaagatgcctcgctactgtctgttcggggacaccgtcaa
cacagcgtcacggatggagagcaatggagtggtgtctacacttacatatatagacacgct
taa

DBGET integrated database retrieval system