KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00011872G001Help
Entry
GSTEN00011872G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K13376  transforming growth factor beta-2
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04060  Cytokine-cytokine receptor interaction
tng04068  FoxO signaling pathway
tng04110  Cell cycle
tng04218  Cellular senescence
tng04350  TGF-beta signaling pathway
tng04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00011872G001
   04350 TGF-beta signaling pathway
    GSTEN00011872G001
   04068 FoxO signaling pathway
    GSTEN00011872G001
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    GSTEN00011872G001
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00011872G001
   04218 Cellular senescence
    GSTEN00011872G001
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    GSTEN00011872G001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:tng04052]
    GSTEN00011872G001
   00536 Glycosaminoglycan binding proteins [BR:tng00536]
    GSTEN00011872G001
Cytokines and growth factors [BR:tng04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   GSTEN00011872G001
Glycosaminoglycan binding proteins [BR:tng00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   GSTEN00011872G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta
Motif
Other DBs
NCBI-ProteinID: CAF95278
UniProt: Q4SVQ4
Position
undetermined
AA seq 520 aa AA seqDB search
MNLCLVGLLLAARLATVALGLSTCSTLDMEQFKRKRIEAIKGQILSKLKLAKPPSQFPEP
EDASPDVVAIYRSTRDLLQEKANERAATCERQRSEEEYYAKEVHKIDMQPFYPSEKTCPQ
RQLEQPADELGSDFKERAKRSWGSWRKQSGGACTCNLICSDASGDIISHTHFNPYFRRLM
FDVSSMERNASNLVRAELRVFRLQNPAAKVAEQRIELYQILGHKDFTSPTQRYIDSKVVR
TQTEGEWLTFDVTEAVSEWLNHRGRSIRRRFRHGQVPLSPPDRCLRFSSGRNSGFKLSLH
CPCCTFVPSNNYIIPNKSEELEARFAGIDDSFIHGGDLKMFKGQRHSARAPYLLLMLLPT
YRLESQFQHKNYRSKRALDAAYCSRNVQDNCCLRSLYIDFRKDLGWRWIHEPKGYEANFC
AGACPYLWSADTQHSKVPMKGWDPAGWPRVSVGFWAFWTSVLTVSHLQVLGLYNTINPEA
SASPCCVSQDLEPLTILYYIGKTPKIEQLSNMKVKSCKCS
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgtgtctggtcggcctcctcctggcggcgcgtttggccaccgtggccctgggt
ctgtccacgtgcagcacgctggacatggagcagttcaagaggaagcgcatcgaggccatc
aaggggcagatcctgagcaagctgaagctcgccaagccccccagccagttccccgagcca
gaggacgcgtctccagacgtcgtggccatttacaggagcacgcgtgacctgctgcaggag
aaggcgaacgaacgcgcggcgacgtgcgagcggcaacggagcgaggaggagtattacgcc
aaagaggtgcacaagatcgacatgcagcccttctatccgtcagagaaaacgtgcccgcag
cggcagctcgaacagcccgctgacgagcttggcagtgatttcaaagagagagcaaagaga
tcctggggaagctggcggaagcagagcggcggagcgtgcacgtgcaacttgatctgctct
gatgcttccggtgatatcatctcccacacacacttcaatccctacttcaggcgactcatg
tttgacgtgtcctccatggagcgcaacgcctccaacctggtcagggccgagctgcgggtt
ttccgtcttcagaaccctgcagccaaagtggcggagcaacgcatcgagctctaccagatt
ttaggacacaaagacttcacctcccccacacagcggtacattgacagcaaggtggtgcgg
acacaaacggagggcgagtggctgacctttgacgtgaccgaggccgtgagcgaatggctg
aatcacagaggtcggagcatccgtcggcgtttccgccacggccaagttcctctgtctccg
cctgatcgctgccttcgcttctcctcaggcagaaacagtgggttcaaactcagcctgcac
tgtccctgctgcacctttgttccatccaataactacatcattcccaacaagagcgaggaa
ctggaggcgcgctttgcaggcattgacgacagcttcatccacggcggcgacctaaagatg
tttaaggggcagcgccacagcgctcgagctccctacctgctcctgatgctgttgcccacc
tatagattggagtctcagttccagcacaagaactaccgctccaagagagccctggatgct
gcctactgctcaagaaatgttcaggacaactgctgcttgcggtcgctctacatcgacttc
aggaaggacctgggctggaggtggatccatgagccgaagggctacgaggccaacttctgc
gctggggcttgtccgtacctgtggagcgccgacacccagcattccaaggtaccgatgaag
ggctgggacccagccggttggcctcgagtgtctgtgggcttctgggctttctggacttct
gttctgaccgtttctcatcttcaggtgttgggtttgtacaacaccatcaaccccgaagcg
tcagcgtcgccttgctgtgtctcccaggacctggagcctctcaccatcctctactacatc
ggcaagacgcccaaaattgagcagctttccaacatgaaggtcaagtcctgcaagtgcagc
tag

DBGET integrated database retrieval system