KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00012314G001Help
Entry
GSTEN00012314G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04060  Cytokine-cytokine receptor interaction
tng04068  FoxO signaling pathway
tng04144  Endocytosis
tng04218  Cellular senescence
tng04350  TGF-beta signaling pathway
tng04520  Adherens junction
tng04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00012314G001
   04350 TGF-beta signaling pathway
    GSTEN00012314G001
   04068 FoxO signaling pathway
    GSTEN00012314G001
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    GSTEN00012314G001
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    GSTEN00012314G001
  09143 Cell growth and death
   04218 Cellular senescence
    GSTEN00012314G001
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    GSTEN00012314G001
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    GSTEN00012314G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tng01001]
    GSTEN00012314G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     GSTEN00012314G001
Protein kinases [BR:tng01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   GSTEN00012314G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ecTbetaR2 Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: CAF95595
UniProt: Q4SUT7
Position
undetermined
AA seq 644 aa AA seqDB search
MDQMSSDLRRRRAEAQEEEAAEGGPASVFVMNQLNERLETFRNLLPNRLNLPAGMPGFLP
LNQLCKFCDVEPSSCSGTGTCGSSCNITSICQLPEEVCVAIWRKNETGFFMETLCHDPSK
SLYGLMLDDHNSSTCVMREKNTTSGTAHVCSCRAEECNDVLSFSPAERDFEKVPSAETSP
ARRSRTGCRLFSSHRARSDSWPLSGPAGTPASEEAVMLAESAKAADSEDTVVDPTPEDSL
VSVVLVSLLPLLVMGVVIGAMFYWYRVHRPRMHSQEWERGIKKRKPKSGGLDCSDVCVIM
MDDDGSDSSSTLANNLNHNTEPLPIELDQLVGKGRFAQVFKAKLKQNASDQFETVAVKIF
PYEEYASWKNEKDIFSNSDLRHENILHFLTAEEKKAQRQYWLITAFHARGNLQEYLTHNV
ISWEELKILGSSLAQGVSHLHSDRLPCGRPKVERVAIVHRDLKSSNILVKSDLTCCLCDF
GLGLQLDSSLSVDDLANSGQVGTARYMAPEVLEARLNLENTESFKQADIYSMALVLWESD
IEVRRCRRGEGLRACLRLQGARAPCVESMKDNVLRDRRRPEIPDTWLRRQGVAMMCGTIM
ECWDHDPEARLTAHCVAKRISEMEDELDKLSSHSSSTEKIPEEL
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atggaccagatgagctcagatctgaggaggaggagggcggaagcccaggaggaagaggct
gctgaaggaggccctgcaagcgtgtttgtgatgaaccagctgaatgaaagactggagacc
ttcagaaacctcctccctaatcgcctgaaccttcctgcaggtatgcccggctttctgccc
ttaaatcagctctgcaagttctgcgacgtggagccctccagctgcagcgggacggggacc
tgcgggtccagctgcaacatcacctccatctgccagctgcctgaagaagtctgcgtggcc
atctggaggaagaacgagacgggattcttcatggagacgctgtgtcacgacccttccaag
tctctttacggcttgatgctagatgatcacaacagctccacctgcgtgatgagggagaag
aacacgaccagcgggacggctcacgtctgctcctgcagggcggaggagtgcaacgacgtt
ctgagcttctcccctgctgaaagagactttgagaaggtgcccagtgcggagaccagtcca
gcccggcggagccgcacaggctgccgactgttttcctcccaccgcgctcgctcggacagt
tggccgctgtcgggtccggctggcacgcccgcctcagaggaggcggtgatgctggcagag
tctgctaaagcggcggactctgaggacaccgtcgtggatccgacccctgaagactctctg
gtgtcggtggttctggtgagcctgctccccctgctggtgatgggcgtcgtcatcggcgcc
atgttctactggtaccgcgtgcaccggccccgcatgcacagccaggagtgggagaggggc
atcaagaaacgcaagcccaaaagcggcggcctggactgcagcgacgtctgcgtcatcatg
atggacgacgacgggtccgacagcagctccacgctcgccaacaacctgaaccacaacacg
gagccgctgcccatagagctggatcagctggtgggaaagggccgcttcgcgcaggtgttc
aaggccaagctgaagcagaacgcatctgatcagttcgaaacggtggccgtgaagatcttc
ccgtacgaggaatacgcgtcctggaagaacgagaaggacatcttctccaattcggacctg
cggcacgagaacatcctccacttccttacagccgaggagaagaaggcccagaggcagtac
tggctcatcaccgccttccacgccagagggaacctgcaggaatacctgacgcataatgtg
atcagctgggaggagcttaagatcctggggagctccttagcccagggagtgtcccacctc
cacagtgaccgcctcccctgcggacgcccgaaggtagaacgtgtggccatcgtccaccgt
gacctcaagagctccaacatcctggtgaagagcgacctgacgtgctgcctgtgcgacttc
ggcctgggcttgcagctggacagcagcctgtcggtggatgacctggccaatagcggacag
gtgggtacggcccggtacatggctcccgaggtgctggaggcccggctgaacctggaaaac
accgagtccttcaagcaggccgatatctactccatggcgctggtgctgtgggagagtgac
atcgaggtgcgacgctgtcggagaggtgaaggactacgagcctgcctacggctccaaggt
gcgagagcaccctgtgtggagagcatgaaggacaacgtgctgagagacagaagacggccc
gagatccccgacacctggctcagacgccagggcgtggcgatgatgtgcggcaccatcatg
gaatgctgggaccacgaccccgaggcccggctcacggcccactgcgtcgccaagcgcatc
tcagagatggaagacgagttggacaaactgtccagccacagctcgtccaccgagaagatc
cccgaggagctg

DBGET integrated database retrieval system