KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00012450G001Help
Entry
GSTEN00012450G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K05292  GPI-anchor transamidase subunit T
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00563  Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
tng01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00563 Glycosylphosphatidylinositol (GPI)-anchor biosynthesis
    GSTEN00012450G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gpi16
Motif
Other DBs
NCBI-ProteinID: CAF95701
UniProt: Q4SUI1
Position
9
AA seq 457 aa AA seqDB search
PEDDFKEELVIRPLHSGDIYASFQFRTLWKTDFRENKVSHYGLFPKSLGQVISKFSVREL
HISFTQGYWRTMQWGQPYQPAPPGAELWVWFQDSVTDVDGTWKELTNVLSGIFCASLNFI
DSTNTVQPSASFKPLGIGNEWSLFKMFSRTLTEACPLASSSKIYVDITDSPQGEHLEVSP
ATPLLSQAVALGDRRTFSVYDLTQKNTFGMTHSLNLLIRWKSNEGDMLRPLLHAERYVAG
YGLHTGEIHTLVYNNHPYRAFPVLLLESVPWYLRLYVHTLTVTSKGKDNKPSYIHYQPSK
DRVRPHLLEMLIQLPPISVTEVTVQFERALLKWTEYTPDPNHGFYVGSSVISSLVPSIVA
MDTNMTQERPLFSSFFPNQEETTYFTRIYTEPLLVNLPTPDFSMPYNVICLTCTVVAVGY
GSLYNLLTRSFQVEEASQGLAKRIANVIRRMRGVPPL
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
ccagaagatgattttaaggaggaattggtcattagaccattacattctggagatatatat
gccagcttccagttccggaccctgtggaaaactgatttcagagaaaacaaagtgtcccac
tacggcctcttccccaagtctctgggccaggtcatctccaagttctcagtgcgagagctg
cacatctccttcacgcagggctactggaggaccatgcagtgggggcagccctaccagccg
gcccctcctggcgctgagctctgggtctggttccaggactctgtgacagatgtggatggg
acttggaaggagctgaccaatgttctgtcggggattttctgcgcttcactgaacttcatc
gactccaccaacacagttcagcccagcgcgtcgttcaaacctctgggcataggaaatgag
tggtccctgtttaagatgttttcacggaccctgactgaagcttgtccactggcctcctcc
agcaaaatctacgtggacatcaccgacagccctcagggtgagcatctcgaggtgagtccc
gccactcctctgctgagccaggctgttgcactgggggacaggcggaccttttctgtctac
gatctgacacaaaagaacacctttggcatgacgcactcgctcaacctgctgatccgctgg
aaatccaatgagggggacatgctgcgtccgctgctccacgccgagcgttacgtggctggt
tacgggctgcacacgggcgaaatccacacgctggtgtacaacaaccacccctaccgggcc
ttcccagtgctgctgctggagtcggtgccctggtacctgcgtctctacgtccacacgctc
accgtcaccagtaaaggaaaggacaacaagcccagttacatccactaccagccgtccaag
gaccgcgtcaggccccacctgttggagatgctgattcagcttcctcccatttctgtcacc
gaagtgaccgtgcagttcgagagggcgctgctcaaatggaccgaatacactcctgatccc
aaccacggcttctatgtcggctcttcggtgatcagttcccttgtgccgagcatcgtcgcc
atggatacaaacatgactcaggaacgcccacttttcagcagctttttcccaaaccaagaa
gaaaccacctacttcacgcgaatatacacggagcccctgctggtcaacctgcccactccg
gatttcagcatgccgtacaacgtcatctgcctgacctgcaccgtggtggccgttggatac
ggctcgctttacaacctactgacccgcagcttccaggtggaagaggccagccagggcctg
gccaaacgcatagccaacgtcatccggaggatgagaggcgtgccgccgctctga

DBGET integrated database retrieval system