KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00013040G001
Entry
GSTEN00013040G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K08268  hypoxia-inducible factor 1 alpha
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04137  Mitophagy - animal
tng04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    GSTEN00013040G001
   04137 Mitophagy - animal
    GSTEN00013040G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tng03000]
    GSTEN00013040G001
Transcription factors [BR:tng03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    GSTEN00013040G001
SSDB
Motif
Pfam: PAS_11 PAS_3 PAS PAS_9 PAS_4
Other DBs
NCBI-ProteinID: CAF96125
UniProt: Q4STA7
Position
16
AA seq 410 aa
MEKKAETASVKRGSTEQRKLRSRDAARYRRSQETEVFYELAHTLPLPRRVSTHLDKSAIM
RVSLSFLRMRKLLQTADGDKRESEEDDPMDGFYPQTLAGFIMVLTEEGDMIFLTENVNKY
IGIVQLELLGQSIYDFVHPCDQEELTDLLAPRPGLNKKQVKEMPSDINFFLRMKSTLTAR
GRTVNIKSAEWKVLHCTGHMCPFDAEVSSAARVMVLLCEPIPHPSSVEFPLDTYTFLTRH
SMDLRFTHCEGRVTELVGYKPDDLIGRSAFEFHHALDSDHISRSLRTLLSKGQVSTSRYR
FLANHGGFVWAETQATVLYNGKTSQPEAIVCLNFILRIRRRWIWRCWLRTYPWTMTSSSP
FSALCRRKKTKTLPILARSPPHSQRTTKAWMKDIFIVRPPDLSPPVSLLT
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggagaagaaagcggagacggcgagtgtcaaacggggcagtacggagcagaggaaactg
cgctcccgggacgccgccagatacaggcggagtcaggagacggaggtgttctacgagctc
gcccacactctgccgctccctcgccgggtgtccacccatctggacaagtccgccatcatg
agagtctccctcagcttcctgcgcatgcggaagctcctccagaccgccgacggtgacaaa
agggagagcgaggaggacgatcccatggacggcttctaccctcagaccctggctggcttc
atcatggtgctgacggaggaaggagacatgatcttcctgacggagaacgtcaacaagtac
atcggcatcgtgcagctggagctgctgggtcagagtatttatgacttcgtccatccctgc
gaccaggaggagctgacagacctgctggctccacgtccaggtttgaataagaaacaggtg
aaagaaatgccaagtgacatcaacttcttcctgcggatgaagagcactctgaccgccagg
gggcgcaccgtcaacatcaaatcagccgagtggaaggttctccactgcacgggtcacatg
tgtccgttcgacgcggaagtgagctcagctgctcgagtcatggtgctgctgtgcgagccc
attcctcacccctccagcgtggagtttcccctcgacacctacaccttcctcacccgccac
agcatggaccttcgctttactcactgcgagggcagggtgacagagttggtgggatacaag
cccgacgacctcatcgggcgctcagcttttgagtttcaccacgcgctcgactccgatcac
attagcaggagcctccgcacgttactgtccaagggtcaggtgagcaccagtcgctatcgt
ttcctggccaaccacggcggctttgtctgggctgagacgcaggccaccgtcctctataac
ggcaagacctcccagcctgaagccatcgtctgcctgaacttcatactcaggatacggagg
agatggatttggagatgttggctccgtacatatccatggacgatgacttccagctcacct
ttctcggcactctgtcggaggaagaagacaaaaaccctgccaatcttagcccgctctcca
ccgcactcacagcgaacaacaaaagcttggatgaaggacattttcatcgtccgtccaccc
gatctgtcgccgcccgtctcccttctgacatga

DBGET integrated database retrieval system