KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00014659G001
Entry
GSTEN00014659G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00230  Purine metabolism
tng00240  Pyrimidine metabolism
tng01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    GSTEN00014659G001
   00240 Pyrimidine metabolism
    GSTEN00014659G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     GSTEN00014659G001
SSDB
Motif
Pfam: dNK
Other DBs
NCBI-ProteinID: CAF97333
UniProt: Q4SPU9
Position
7
AA seq 326 aa
AAGKSTLVRLLEGASEDWEVIPEPIGKWCNIDKVGDDVYQELSSSQKSGGNILQMLYHQP
SRWAYTLSGKDPVLWGDFQRLTCLSSSVWQSYTCISRVRSQLQRPSGKLKEAGNPVQFYE
RSVYSDRFVFASNLFEGGDMTETEWSVYRDWHTWILKQCEPAIALDAIIYLRAPPQVPGR
GPGLCVLTKVQGRGCSDDAFRLNTVACFFTLHAAPAPPGQGGGAGPSSGVSGTASPQTRV
LAVPQEHEVSRPPSTPPHARAQIKSDGVTEMSVLLSGWTSTTSTTFPFSSSTLTTTSRAT
GSNGKPSSTRFRTLPGVRFRRFFRLC
NT seq 981 nt   +upstreamnt  +downstreamnt
gctgcgggaaagtcgactttggtgcgccttcttgagggagcatcagaggactgggaggtg
attcctgaacctatagggaaatggtgcaacatcgacaaagtcggtgatgacgtgtaccag
gagttgagctcctctcagaagagcggaggaaacatcctgcagatgctgtaccaccagccg
agccgctgggcctacacactttcaggtaaggatcccgtcctctggggtgatttccaaagg
ctgacctgcctgtcctcctcggtctggcagagctacacctgtatcagcagggttcgttca
cagcttcagcgtccgtcgggtaaactcaaggaggccggaaatcccgttcagttctacgag
cgctccgtttactcggacaggttcgtgtttgcgtccaacctctttgagggcggcgacatg
acagaaacggagtggagcgtttaccgggactggcacacctggatcctgaagcagtgtgag
cccgccatcgccctggacgccatcatctacctgcgagcaccgccacaggtaccagggagg
ggccccggtctttgtgtcctcacaaaggttcaaggacgtgggtgctcagacgatgccttc
aggctcaacacggtggcctgttttttcacgctgcatgcagcgcctgctccaccggggcag
ggaggaggagcagggccttcctctggagtatctggaacagcttcacctcaaacacgagtc
ctggctgtaccacaggaacacgaggtgagcaggccgccgagcacgccgccgcacgctcgt
gcgcaaatcaagagtgatggcgtgacggagatgagtgtgctgctttcaggctggacttcg
actacctcaacgaccttcccgttctcgtcctcgacgttgacgacgacttcaagagcgacg
ggatcaaacgggaagccatcatcgacaaggttccgcacccttcctggtgtccgtttccgc
cgtttcttccgactctgctaa

DBGET integrated database retrieval system