KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00014829G001
Entry
GSTEN00014829G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K09098  neuronal PAS domain-containing protein 1/3
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tng03000]
    GSTEN00014829G001
Transcription factors [BR:tng03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    GSTEN00014829G001
SSDB
Motif
Pfam: PAS_3 PAS PAS_11 PAS_4 PAS_9 SAGA-Tad1
Other DBs
NCBI-ProteinID: CAF97456
UniProt: Q4SPH6
Position
16
AA seq 800 aa
MATMPFVSEGKCVSVEWDFLQGLLAKPPTLPCQLDKASVIRLTISYLHMRTFASQGDPPW
SPLMEGDSNCSKVRRSSHSLATDMFEQHLGAHLLQSLDGFVFVVSHEGRFLYISETVSIY
LGLSQSPSIRKRTLVLRTLVKKEVAQHEAPATSEFDSHTRPAVELTGSSVFDYIHPADHV
EMAERLGIRPHLRAEAGCHTAPESASSSASTSSLSGTPEPAPSSPHSITDEPPDRGFFIR
MKSTLTKRGLHVKSSGYKVIHVTGRIRCRPALVPGSTRSVRRPMGLVALAHTLPPSTLNE
VRMESHMFVFRVNMDLQVIYCENRISEYMDLTPAEVVGHTCYHFIHVEDLENLRQSHEDL
LRKGQVVTGYYRWLQRRGGYLWIQSTATVSINHKAPHERNVIWVNYVLSRNEMADTPLDL
LQLPESIRAERLRSSSSPASGSPQTRGSHSSVGKNDTDNKGRDKFASAAVQSEDRRKRQL
RSDPEGAPPETRRRLEEIRHTEESVSVSSDLASDSDGEEEEETEWEQGGSSDRMKPEDGG
AAGKPSRGADPPAAGERVSRVHNGRAVIQHLKSIVAPSALPGSPGIKTEHDALTSGGRWA
PHTQASQPQPSHAHTPSSSLNGDSPTTPIPDSSSTNEAPPKVLFTPPSPALSPAMSVSSP
LPRDERAVSGVVSRSGGGGAGSGPDFELLQRLAAGGAAGRVLFHPLALSPQGPQSLYAPS
TIRYAPPELPPSHHHGAGHGDGLQLRSDHHKGPPPAFFPHLQRLAGLPPFSGFSPSDSPF
SSSLPFCMNGLRGAAGSEED
NT seq 2403 nt   +upstreamnt  +downstreamnt
atggccaccatgccgttcgtcagcgaggggaagtgtgtgagtgtggagtgggatttccta
caaggacttctggccaagcctcctaccttgccctgccagttagacaaggcctcagtcatc
cggctgaccattagctacctgcacatgcgcacttttgccagccagggagacccaccctgg
agccccctcatggagggagacagcaactgcagcaaagtaagacgatcatctcattctctg
gcgactgacatgtttgagcagcaccttggggcacatctcctgcagtctctagatggcttt
gtgttcgtggtcagtcacgagggacgcttcctctacatctcagagacagtttcaatctac
ctgggcctctcacagtcaccgagcattagaaaacgtacacttgtactgaggactttagtg
aagaaggaggtggctcagcatgaggccccggctacctccgaatttgactctcacacgcgt
cctgcagtggagttgaccggcagcagcgtcttcgactacatccacccagcggatcacgta
gaaatggccgagcggctggggatcaggccgcacctgagggccgaggccggctgccacacg
gcccctgagagcgcctccagctcggcgtccacctcctccctgtctggtactcctgaacca
gctccttctagtcctcattccatcaccgatgagcctcctgatcgcggcttcttcatccgg
atgaagtccacgctgactaaaagaggcctccatgtgaagtcgtccggatacaaggtgatc
cacgtgacaggacggatccgctgccgccctgctctggtcccggggtccacgcgctccgtg
cgccgaccgatgggtttagttgcgctggcacacacgcttccgccatccacgcttaatgag
gtccgcatggagagccatatgtttgttttcagagtgaacatggacctgcaggtcatatat
tgtgagaacaggatctcagagtatatggatctgaccccagcggaggtcgtgggacataca
tgttaccacttcattcatgtagaagacctggaaaacctgcgtcagagccacgaggacttg
ctgaggaaaggtcaagtggtgaccggatactaccgttggctccagagacggggaggctac
ctgtggatccagtccacagccaccgtctccatcaaccacaaagcgccgcacgaacgcaac
gtcatttgggtgaactacgtgctgagtcgaaacgaaatggccgacactcctctggatctg
ctgcagctgccagagagcatcagggctgagaggctgcgaagtagctcgtcacccgccagt
ggctccccgcagaccagaggctcgcatagctcggtggggaagaatgacaccgacaataaa
ggcagagacaaattcgcctccgctgccgtccaatcggaggacaggaggaagcgccagctg
aggtcggatcctgagggcgccccgcctgaaacgcgccgccggctggaggagatccgccac
actgaggagagcgtgtcagtgtcctctgacctggccagcgacagtgacggggaggaggag
gaggaaacggagtgggagcaggggggcagcagcgaccggatgaaacctgaagacggcgga
gccgcaggtaagcccagcaggggggccgaccctccggctgcgggggagcgggtcagcagg
gtgcacaacggtcgggccgtcattcagcacctgaagagcatcgtggccccctctgccctg
ccggggagtcccggcatcaagactgagcacgatgccctcaccagcggggggcgctgggca
cctcacacgcaagcctcccaaccccagccctcgcacgcacacacaccctccagcagcctg
aacggcgacagccccaccacacccatccctgactcctcttccacgaacgaggccccgccg
aaagtcctgttcacgcccccctccccggccttgtctcccgccatgtccgtgtcctccccg
ctcccccgtgatgagcgggccgtgtcgggggtggtcagtcgcagcggcggcggcggggca
ggcagcgggcccgactttgaactgctccagagactagctgccggtggggcagcggggagg
gtcctcttccaccccctggccctcagcccccaaggccctcagagcctctacgcccccagc
accatccgctacgctccacctgagctgcccccctcccaccaccacggcgccggacacggc
gacggcctgcagctacgctcggaccaccacaaggggcccccgccggccttcttccctcac
ctgcagcggctggccggcctgccccccttcagcgggttctccccctccgacagccccttc
tcctccagcctgcccttctgtatgaacggcctgaggggggccgcaggctcggaggaggac
tga

DBGET integrated database retrieval system