KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00015369G001
Entry
GSTEN00015369G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K09097  aryl hydrocarbon receptor nuclear translocator
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tng03000]
    GSTEN00015369G001
Transcription factors [BR:tng03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    GSTEN00015369G001
SSDB
Motif
Pfam: PAS PAS_3 PAS_11 HLH PAS_9 HAUS2
Other DBs
NCBI-ProteinID: CAF97872
UniProt: Q4SNB0
Position
8
AA seq 679 aa
IRCDDETTGSNNDKERFARLLDEDQSFADKEKLARENHSEIERRRRNKMTAYITELSDMV
PTCSALARKPDKLTILRMAVSHMKSLRGSGNTNSDGSYKPSFLTDQELKHLILEAADGFL
FVVSCETGRIVYVSDSVTPVLNQSQSDWFGSSLYDQLHPDDTEKLREQLSTVENNNTGRM
LDLKTGTVKKESQQSSARMSMGARRSFICRMRCGSCPVEPLSMNRLNFLRNRNRNGLGAP
KEGEPQYVVVHCTGYIKSWPPAGVSLNEDETENTQGSRFCLVAIGRLQVACCPGNTDINN
VSVPAEFISRHNCQGMFTFIDHRCVGAIGYQPQVTTETGSRLAARRRPELLGKNILELAH
PEDQGLLRDSFQQAVKLKGQVLSVMYRFRSKSRDWIWIRTSSFTFQNPFSEEIEYIICTN
VNMPGQPGAAAGPDHSKSLEKPELYPPLFQGSEQTKVLPPTPAPPAQIYTPNSNFPASRS
GDVYRPVSMPSQMMAQPGTAGQMLAQMSRQNSVAHSVTPSGTGAPLHGGPTPGGWPGAAG
GAGARPQFNNQQVAPHAAKTTSPPFPRMGGFGGGSSSSFEQMPTGASPTTTSGGNYPAIN
VRAGLSNNGYDGSQSGGQYPPRAAEAVWPQWQGQQNNAEQQPHAQGNQDMFPDVLSILDQ
PPNFNNDDFEIPIYSQFNE
NT seq 2040 nt   +upstreamnt  +downstreamnt
attaggtgtgatgatgaaacgacaggctccaacaatgacaaggaacgcttcgccaggttg
ttggatgaagatcagagttttgcagataaggaaaaactagcgagagagaaccacagcgag
atcgagaggcgcaggcgaaacaagatgacggcctacatcaccgaattgtccgacatggtg
cccacctgcagcgcactggcccgcaaaccagacaaactaaccatcctgagaatggccgtg
tctcatatgaaatccctgagggggagcgggaataccaactcagatgggtcgtacaagccc
tcgtttctcaccgaccaggagctgaaacatctcatattggaggcagcagatggttttctg
ttcgtggtttcatgcgaaactggacgcatcgtttacgtctcagactccgtgacgcccgtc
ctcaaccagtcgcagtccgactggttcggctcctccctctacgaccagctgcacccagac
gacacggaaaagctcagggagcagctctcgactgtggagaacaacaacacagggagaatg
ttggacctgaaaacggggaccgtgaagaaggaaagccagcagtcgtcggccaggatgagc
atgggagcccgccggtcgttcatctgcaggatgaggtgcggctcctgtccggtggaacct
ttatccatgaacagactcaacttcctcaggaatagaaacaggaacggcctgggtgcaccc
aaggaaggagagccccagtatgtagtcgtccattgtacaggatacatcaaatcctggccc
cccgcaggagtgtcgttaaatgaagatgaaacagaaaacactcaagggagtcgcttctgc
ctcgtcgccattgggagattgcaggtagcttgttgccctggtaacacagacatcaataac
gtcagcgtgccagctgagttcatctcgcgccacaactgccagggcatgttcaccttcata
gaccaccgctgcgtaggcgctatcggataccagccccaggtaaccaccgagaccgggagt
cggttagcagctcggcgccgcccggagctactggggaagaatatcctggagctggcacat
cctgaagaccagggcttactgagggacagttttcagcaggcggtgaagctgaagggccag
gtcctctccgtcatgtaccgattccgctccaaatccagagactggatctggattcggacc
agctccttcaccttccagaacccgttctctgaggagatcgagtatatcatctgcaccaac
gtcaacatgccgggccagccgggggcggcagcagggccggatcacagcaaaagcctggag
aaacccgagctctacccccctctttttcaagggtcggagcagaccaaggttctgcccccc
acccctgctcccccggcacagatctacaccccaaacagcaactttcctgccagtcgttcc
ggtgacgtgtacaggcccgtcagcatgccctcgcagatgatggctcagccaggcacggca
gggcagatgctcgcccagatgtcccgtcagaacagcgtcgcacattcagttaccccctcc
ggcactggcgcgcccctccacggaggacctaccccaggagggtggcctggagctgcaggc
ggagctggagccagaccacagtttaataaccagcaggtggcgccacatgcggccaaaacc
acatccccaccgtttccacgcatgggagggttcgggggcggctcctccagctcctttgag
cagatgcccaccggtgcgtctcccaccacgaccagcggcggaaactacccggccatcaac
gtgcgcgctggcctcagcaacaacggctacgacggctctcagtcggggggccagtacccc
ccacgggcagcggaggcagtgtggccccagtggcagggccagcagaacaacgcggagcag
cagccacatgctcagggaaaccaggacatgttccctgatgttttgtccatactggaccag
cctcccaacttcaacaacgatgactttgagattcccatctactcccagtttaacgagtga

DBGET integrated database retrieval system