KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00016121G001Help
Entry
GSTEN00016121G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04270  Vascular smooth muscle contraction
tng04350  TGF-beta signaling pathway
tng04510  Focal adhesion
tng04530  Tight junction
tng04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    GSTEN00016121G001
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    GSTEN00016121G001
   04530 Tight junction
    GSTEN00016121G001
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    GSTEN00016121G001
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    GSTEN00016121G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tng01001]
    GSTEN00016121G001
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tng03036]
    GSTEN00016121G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     GSTEN00016121G001
Protein kinases [BR:tng01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   GSTEN00016121G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    GSTEN00016121G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Rho_Binding HR1 PH C1_1 Cortex-I_coil Pkinase_C APH
Motif
Other DBs
NCBI-ProteinID: CAF98420
UniProt: Q4SLR2
Position
15
AA seq 1375 aa AA seqDB search
DGLDALVYDLDFPALRKNKSIDNFLNRYKETINKIRDLRMKAEDYEVVKVIGRGAFGEVQ
LVRHKFTSKVYAMKLLSKFEMIKRSDSAFFWEERDIMAFANSSWVVQLFFAFQDDRYLYM
VMEYMPGGDLVNLMSNYDVPGKWARFYTAEVVLALDGIHSMGFIHRDVKPDNMLLDKTGH
LKLADFGTCMKMNKDGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEM
LVGDTPFYADSLVGTYSKIMNHKNALTFPDDSDISNDAKNLICAFLTDREVRLGRNGLDE
IKRHPFFKNDQWTWENIRDTAAPVVPELSSDIDTSNFDDIEEDRGEEETFPVPKAFVGNQ
LPFVGFTYYSNQHTASKTSDKRGSSTKEDKSHLENLQKRIYQLEEQLHSEMQLKDELEQK
CRSSHTKLEKIMKELDEEANIRKNAESSVSLLEKDKIMLQHRFTEYQRKADQEAEKRRNL
ENEVSTLKEQLEDMRKISQNSQASNDKIIQLQNQLEEANDLLRAESDTAARLRKNHTEMA
KSMSQLESLNRELQERSRAIDSEKAQLEKEVLLIQSTLDSERRNYSQGSEEIRELQARMA
GLQEDNKSLKLSLSKVEAERKQAQERSNNLEKEKNNLEIDLNYKLKTLQQRLEQEQTEHR
VTRAQLTDKYESIEEAKSAAMNAVQQKTSEEIGARMRAESRVVEVEKQCSMLEFDLKQSV
QKMEQLMKQKERLEDEACIFSICRIFPFQVKSLRIQGEQDLSKRALAQSELKSRMQEVDR
LRCSEKQLKQEINTALESKRSLEFQLAQLTKGNEGQMRELQDQLEAEQYFSTLYKTQVKE
LKEEIEEKNRQVQETHKRVQDLSSERDSLSAQLDLTVTKAESEQLARALQEEQYFELSQE
NKKAGARHKQEIMEKDAIISRLEESNKTLTKDAENLSKEKTELNDKLQAQEQEFLAQKEE
ISNTIKANYEKTLNTERTLKTQAVNKLAEIMNRKDMKLDHKKKGSTADLRRKEKENRKLQ
QELNLEKEKFNHMAIKYQKELSEMQAQLSEEFVNRNELQMQLDSKESDIEQLREKLNDLQ
QRMDNSSITSLQADETDSNIAESRLEGWLSIPNRVNIKRYGWKKQYVVVSSKKILFYNDE
QDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPRIFQVKLFILAERSLFPMTSLSC
VSRVAHCRAVLKCVSVHLQILYANEGECRKEADMEPVLQGDKTNCFPHKGHEFIPTLYHF
PSNCEACSKPLWHVFKPPPALECRRCHVKCHKDHLDKKEDVIAPCKVNYDVTSARDMLLL
ALTQDEQKKWIGHLGKKIPKTPPTTFSRASPRAMSTRTGPNQSFRKNPKSNTGKL
NT seq 4125 nt NT seq  +upstreamnt  +downstreamnt
gatggcttggacgcactggtgtatgatctcgacttcccggctctgaggaaaaacaagagc
atcgacaactttttgaatagatataaggaaaccattaataagatccgggatctgcgcatg
aaagcagaggactatgaagttgttaaagttattgggaggggagcatttggagaggtccaa
ctggtgagacacaagttcacaagcaaggtttatgcgatgaagctactcagtaagtttgag
atgatcaagaggtcggactctgctttcttttgggaggaaagggacatcatggcttttgca
aacagctcctgggtggtacagctcttttttgcattccaagatgaccgctacctctacatg
gtaatggagtacatgccgggtggtgacttggtgaatctgatgagcaattacgacgttcca
gggaaatgggcgcgcttttacactgccgaggtggtgctggccctggacggaatccactcc
atgggcttcatccacagggacgtgaaacctgataacatgctgttagacaaaacaggccac
ctaaaactggccgactttggcacctgcatgaaaatgaacaaggatggtatggtacgatgt
gacacggcagtgggaactccagattatatttcacctgaggtactgaaatcccagggaggt
gatggatattatggcagagagtgcgactggtggtcagtgggagtcttcctctatgaaatg
ttagtgggtgacacaccgttttatgccgactccctggtgggcacctacagcaaaatcatg
aaccacaagaatgccctgaccttccctgatgacagcgacatatccaatgacgccaagaat
ctcatctgtgcttttctgactgacagggaagttcgacttggccgtaatggcttggatgag
attaagagacatcccttcttcaagaatgaccagtggacgtgggagaacatccgagacacg
gctgccccagtggtgcctgaactgagcagcgacatcgacaccagtaactttgatgacatc
gaggaggatcggggcgaagaggagaccttcccagtgccaaaggcgtttgtgggaaaccag
ctccccttcgtaggcttcacttactacagcaatcagcacactgcctcaaagaccagcgac
aaacgtggcagctctacaaaagaggacaagagtcatttggagaacctgcagaaaaggatc
taccagctggaggagcagcttcacagcgaaatgcagctgaaggatgagctggagcaaaaa
tgcaggtcatcacacaccaagcttgaaaagatcatgaaggaactggatgaagaggcaaac
attagaaagaatgcagaaagcagtgtgtctttgctggaaaaggacaagatcatgctgcag
caccgtttcacggagtaccaaagaaaagctgaccaggaggcggagaagagacgcaatttg
gaaaatgaggtgtcaactctaaaggagcagcttgaagatatgagaaagatcagtcaaaac
tcacaggcctcaaatgacaaaattatccagctgcaaaatcagttggaggaggccaacgac
ctcctgcgtgcagagtcggacacagcagcaaggttaaggaagaaccacacggagatggcc
aagtcgatgagccagctggagagcttgaaccgagagctgcaggagaggagccgtgccata
gacagtgaaaaggcccagttggagaaggaggtcctgctaattcaaagcaccctggactca
gagaggagaaactacagccagggatctgaggagatcagggagcttcaagcaaggatggct
gggttacaagaggacaacaaaagcctgaagctcagcctgtcaaaggtggaggcagaacgc
aaacaagcccaggagaggagcaataacctggagaaggaaaagaacaacctggaaattgac
ctgaactacaagctgaagactttgcaacagcgtctggagcaggaacagacggagcacagg
gtgacgcgggcgcagctcaccgacaaatatgagtccatcgaagaagccaaatcagctgcc
atgaatgccgttcagcaaaagacgtcggaagaaattggcgcacgaatgagagctgagagc
cgggttgtggaagttgagaagcagtgctcaatgttggagtttgacctgaagcagtccgtt
cagaagatggagcagttgatgaagcaaaaggaacggctggaagacgaggcatgcattttc
tccatctgtcgtattttcccattccaggtgaagagcctgcgaatacagggagaacaggac
ctgagcaagcgcgcgctggctcagagcgagctgaagagtcgcatgcaagaggtggaccgc
ctcaggtgttctgagaagcagctcaaacaggagatcaacacagctctggagagcaaacgc
tccctggagtttcagttggcacaactaacaaaaggcaacgaaggacagatgagggaactt
caggaccagcttgaagctgaacaatatttttctacactttacaaaactcaggtcaaggag
ctaaaggaggagatagaagaaaagaatcggcaggtgcaggagactcacaaaagggtgcag
gatctgagcagtgaaagggactcgctgtctgcacagctggatctgacagtgaccaaagca
gaatcggagcagctcgcccgggctcttcaggaggagcagtactttgagctcagtcaggag
aacaagaaggcaggggcgaggcacaagcaggagattatggaaaaagacgctattatttcg
cggctcgaggaatcaaataaaactctaaccaaagatgctgaaaacctcagcaaagagaag
accgagttaaatgacaaacttcaggctcaagagcaagagtttttagctcagaaagaagag
atttcaaatacaatcaaggccaattatgaaaagaccctaaacacagaacgcacactgaag
actcaggcggtaaacaagctggcagagatcatgaatcgcaaggacatgaagctagaccac
aagaagaagggcagcacggccgacctgcggaggaaagaaaaggagaaccgcaagcttcag
caggagcttaacctggagaaggagaagtttaaccacatggccatcaagtaccagaaggag
ctgagcgagatgcaggcacaattgtcagaggagttcgtcaatcgcaatgagcttcaaatg
cagctagacagtaaggagagcgacattgagcagctacgagagaaactgaacgacctgcag
caacgcatggacaactccagcatcaccagtctgcaggctgatgagacggacagcaacata
gcagagtccagattggaaggttggctgtccattcctaaccgtgttaatatcaagagatac
ggatggaagaagcagtatgtggtggtgagcagtaagaagatactgttctacaatgacgag
caggataaggagcagtccaacccttcaatggtactagatatcgacaaactatttcatgtg
agacctgttacacaaggagacgtatacagagctgagacggaggagattcccaggattttc
caggtaaaactctttatcctcgctgaaagatcgttgtttccaatgacaagtctgagttgt
gtatctagggttgctcactgcagagcggtgctgaagtgtgtctctgtccatctgcagatt
ctttatgccaatgagggagagtgcaggaaggaggcggacatggagccagtccttcagggg
gacaaaacaaactgcttcccacacaaaggccacgagttcatccccacgctgtatcacttt
ccttccaactgcgaggcctgttccaagcctctgtggcacgtcttcaagccgcctccggca
ctagagtgtcgccgctgccacgtcaagtgccacaaggaccacctggacaaaaaggaagac
gtcatcgctccttgcaaagtaaactacgatgtgacctctgcccgggacatgcttctactg
gccctcacccaagatgagcaaaagaaatggatcggccacctgggaaagaagatccccaaa
acgccaccaaccacgttttcccgagcttcacctcgtgccatgtccactcgcaccggacca
aatcagtctttccgcaagaaccctaaaagcaatactggaaagctg

DBGET integrated database retrieval system