KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00016315G001
Entry
GSTEN00016315G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K09100  single-minded
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tng03000]
    GSTEN00016315G001
Transcription factors [BR:tng03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    GSTEN00016315G001
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS PAS_9 HLH PAS_4
Other DBs
NCBI-ProteinID: CAF98568
UniProt: Q4SLB4
Position
7
AA seq 710 aa
MKEKCKNAAKTRREKENGEFYELAKLLPLPAAITSQLDKASIIRLTSSYLKMRAFFPRGL
GDGWGHSTRYGPLDTMTKDLGSHLLQTLDGFVFVVASDGKIMYISETASVHLGLSQVELT
GNSIFEYIHPSDHDEMTAVLSLCQPAHQHLSQEYEAERSFFLRMKCVLAKRNAGLTCGGY
KVSGGYGVFWNRATTLGGLWDACRRAAACLRAQVIHCSGYLKVRHCMLDLALYESCYQTA
GLVAVGHSLPPSGVTEIKLFSNMFMFRASLDFKLIFLDTRVAELTGFEPQDLIEKTLYHH
VHACDIFHLRYAHHLLLVKGQVTTKYYRMLSKHGGWVWVQSYATIVHNSRSSRPHCIVSV
NYVLSATECKELQLSGDQSPASEAGRAFTSAQEPPRQFRGKGARMRTKARAAPYPEAGSR
SQSDHLSVSPQLDLWKEGPAPCGPAQTHGYRHKQQRPADAPAPPDPGLGRQIGDGGGQAG
LNISSSAAAGKYAGPALAADCRHPDGIRPPSSSCGNQHFEEGAYGGCRSLRSKEPGPCSR
FHGSNGGAGPHGDQALACSWFTGLVLGKDERGGFRGSTGQHVPVQVVLEQKKGPPCRYPA
EGYAPPSDGCRKHGAVLELEKRAAQEQRGLFRGVGLGVELATPSPYVSLNFHHVLGKRGS
FKVGPLSAGAEADEGPGGGSACYASDGPSWESHRDFPSYIGTSVIITNRR
NT seq 2133 nt   +upstreamnt  +downstreamnt
atgaaggagaagtgcaaaaacgccgccaagacgcgacgggagaaggagaacggggagttt
tacgagctggccaagctgctgccgctgccggcggccatcacctcccagctggacaaggcc
tccatcatccgcctgaccagcagctacctgaagatgagggccttctttccccgaggtctg
ggtgatggctggggccactccaccaggtacggtcccctggacaccatgaccaaagacctg
ggctcccacctcctacaaaccctggatggcttcgtgttcgtcgtggcctccgacggtaaa
atcatgtacatctcggagacggcgtccgtccacctgggcctgtcgcaggtggagctgaca
ggaaacagcatctttgagtacatccacccgtcggaccacgacgagatgacggccgtcctg
agtctctgccagccggcacatcagcatttgtcccaagagtacgaagcagagcgctccttc
ttcctgaggatgaagtgtgttctcgctaaacgtaacgcgggcctgacgtgtggcggctac
aaggtcagtggcggctacggagttttctggaatagagcaacaaccctcggaggactctgg
gacgcctgcagacgtgctgctgcttgtttgcgtgcgcaggtcatccactgcagcggctac
ctgaaggtgcgccactgcatgctggacctggcgctgtacgaatcctgctaccagacggcg
ggtctggtggccgtgggccactctctgccccccagcggcgtcaccgagatcaaactcttc
agcaacatgttcatgttccgcgccagcctggactttaagctcatcttcctggacaccaga
gtggcggagctgaccggctttgagccccaggacctgatcgagaagaccctgtaccaccac
gtccacgcctgcgacattttccacctgcgctacgctcaccatttgttgctggtgaagggc
caggtcaccacaaagtattaccgcatgctctccaagcacggaggatgggtgtgggtgcag
agctacgccaccatcgtgcacaacagccgctcctccagacctcactgtatcgtgagcgtg
aactatgtcctcagtgccaccgaatgcaaggagctgcagctgtcgggggatcagagtccc
gcctctgaagcgggtcgcgccttcacctccgctcaggagccccccagacagttcagaggc
aaaggagccaggatgaggaccaaggccagagctgctccctatcctgaggccggcagccgc
agccagtcggaccacctgagcgtgtctcctcagctggacctgtggaaggagggcccggca
ccctgcggccccgctcagacccatggctaccgacacaagcagcagcggcctgccgacgcc
ccggcgccgcccgaccccggtctgggtcggcagatcggggacggcggaggacaagccggt
ctgaacatcagcagctccgcagcagccggtaaatacgcaggtccggcgctggcggctgac
tgccggcaccctgatgggatccgtcctccctcctccagctgtgggaaccaacatttcgag
gaaggggcctacgggggctgcagaagcctccgcagcaaagaaccagggccctgctcccgt
ttccacggcagcaatggtggagcggggccccacggggaccaggccctggcctgctcctgg
ttcactggtcttgtgctggggaaggatgagcgaggcggcttccggggcagtacgggccaa
cacgtccccgtccaggtggtcctggagcagaagaaggggccgccgtgcaggtacccggcg
gagggatacgcgccacccagcgatggctgccggaagcacggagctgtgctcgagttggag
aagagggctgctcaagagcagcggggacttttcagaggcgtggggctgggcgtggaactc
gccactccgtccccgtacgtgtccctcaactttcaccacgtcttgggcaagcgcggttct
ttcaaagtgggcccgctgagcgccggggccgaggccgacgagggcccgggcggaggatcg
gcctgttacgcctccgacggcccctcgtgggagagtcacagagacttcccgtcctacatc
ggcacgtccgtaatcatcacaaacaggaggtga

DBGET integrated database retrieval system