KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00016895G001Help
Entry
GSTEN00016895G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K15261  poly [ADP-ribose] polymerase 10/14/15 [EC:2.4.2.30]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GSTEN00016895G001
Enzymes [BR:tng01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     GSTEN00016895G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Macro PARP WWE Colicin-DNase
Motif
Other DBs
NCBI-ProteinID: CAF98988
UniProt: Q4SK44
Position
2
AA seq 865 aa AA seqDB search
XSFPLKFSTDTIIKAVTEYFDEKHEDVLLKEVHFVDICDSSVEVIVAAVKEQFKARCATQ
SDPLSPRSSPTATTSTSPRNQTTKPPSHPKYLDRVQTKEGLNIALATGKIEDATTDVIVN
SVFKALNLKEGALSNAIFQAAGPQLQVLLNAKKSSGTVGDVIVTEGCQLKSMFVYHAVTP
AKGTAQDQAMKALSGIFRDCLNKAEDRGMTSISFPTIGTGQLGFSKDHVAQVLYGEISKF
SHKRQTKSLTEVTVILYSGDTETQQVFTEELKKHFSKNTVSGRCLLQNVYYLHTVGCTFN
RCTICILGHFSKIITTSEMHETKMGSVTIQAVTGDITKETTDVIVNSSNENFTLKRGVSK
AILEAAGQAVEAECQKLEWQQIVCQMVTANSTLHSRIRIYTTDEKVVVCGHRDAVINVSG
ILQDFLKQNAHVEETVAIKPNTILNYIKIFGKSQIEQIQDKIALSYKNEAICLSGSRADV
LESKKVYTTQLCLSSVAFFSSSAEKPQKDSIIKTVEQKPVCFHICGKSQAGVDSAKKKIN
DQISKERVTNTITDNFISSFSQADSQRITDIQVTLSVRIMQESKQGTESLTIEGLGKDVL
KASNEIQELLRKLRDEEDLKMKEELAGKVAAWQYLQGTGFQNFDSRTNYKLEEALLNNVP
RVEVNIQGQRYTVQMPSGPATDKQGNSLQIRRIDKDEDIPTHWDVVINTSCHTVTLAAGT
AEYKRVQDNDLKVTTNFSVFKIDRIQNPLLWKTLQMKKRNMDQKNGHQNNEKTLFHGTTE
DAVAIINEHGFNRSYAGKNAACYGNGTYFAVNATYSAKDLYSKPNQNGEKHMYLCQVLTG
DYTLGKIGMVVPPPKTLNSVEIIRQ
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
nncagttttccactcaagttcagcacagacaccatcatcaaagcagtgacggagtacttt
gatgaaaagcatgaagacgtcctgttgaaggaggttcattttgtggacatctgtgacagt
agtgttgaagtgatagtggctgcagtcaaagagcagttcaaagcccggtgtgctactcaa
tctgacccactctcgccaaggtcatcccctaccgccaccaccagtacgtcaccaaggaat
caaaccaccaaacctccatcccacccaaaatatttggatcgtgtgcaaaccaaagaaggc
ttgaacatagctcttgctacaggaaaaatagaagatgccacgacggatgtgatcgtgaat
tctgtgtttaaggctctgaatctgaaagaaggggctctttcaaatgccattttccaggcg
gctggtccgcaacttcaggtattattaaatgcaaaaaaatcaagtgggacggtgggagac
gtcatcgtaactgagggatgccagctgaagagcatgttcgtctaccacgcagtcacgcct
gccaagggcactgctcaagaccaggctatgaaggccttgagtggaattttcagggattgc
ctgaacaaggcagaagacagggggatgacatcaatatcattccccaccattgggacagga
cagctcggcttctcaaaagaccatgtggcccaagtgctctatggtgaaatctcaaaattt
agtcacaagagacagactaagagtctgacagaggtgaccgtcatactttactctggagac
acagaaacccagcaggtgtttactgaagaactgaaaaaacacttttcaaagaacactgtt
tcaggtaggtgtttattacagaatgtctattatctgcatacagttggttgtacttttaac
cgttgtaccatttgtattttaggtcacttttctaagatcatcacaacttcagaaatgcat
gaaaccaaaatgggcagcgtgactatacaggcagtcacaggggacatcaccaaagagacc
accgatgtcattgttaactccagcaatgaaaactttactcttaaaagaggagtgtcaaag
gctattttggaagcagctggtcaggctgttgaagctgaatgtcaaaagcttgaatggcaa
cagatcgtctgtcagatggtgactgctaacagcacgctgcacagcagaattcgaatttac
actacagatgaaaaggttgttgtttgtggacacagggacgctgtcataaatgttagcggg
attcttcaagactttttgaaacagaatgctcatgtggaagaaaccgtagcgatcaaacct
aacaccattttaaattacattaaaatctttggcaagtctcaaatagagcaaattcaggac
aaaatagctttgtcttacaaaaatgaagccatatgtttaagtgggtcaagggccgatgtt
ctggagagcaagaaagtttatacgactcaactttgcctttcttctgtagctttcttctcc
agcagcgcagagaagccacaaaaagattctatcatcaaaactgtggagcaaaaacctgtt
tgctttcacatctgtggcaaatcacaggctggtgtagactctgctaagaagaaaatcaat
gaccagatatctaaagaacgtgttacaaacactatcactgacaacttcatctccagcttc
tctcaagcagacagccagcgcataacagacatccaggtgaccttaagtgtcaggataatg
caggaaagcaagcagggcacagagtcactcaccatcgaagggcttggcaaggatgtgcta
aaagcctcaaatgagatccaggagttgctgaggaagttaagggacgaggaggacctgaag
atgaaggaggagctggcaggaaaagtggcagcctggcagtacctgcaggggactgggttt
cagaatttcgattccaggaccaactacaaactagaggaagcacttttaaataatgtacca
cgtgtcgaggttaacatccaggggcaacgctacactgttcaaatgccaagtggaccagct
actgataagcagggaaacagcctccagataagacgcattgataaagatgaagacataccg
acgcactgggacgtcgtgatcaacacctcgtgccacactgtcacccttgcagcagggaca
gctgagtacaagagagtccaggataatgatttaaaagtaacaactaacttttctgtcttt
aagatcgatcgcatccagaacccgttattgtggaagactctgcagatgaagaaacgtaac
atggaccagaaaaatggacaccagaataatgagaagactctctttcacggcaccactgag
gacgctgtagccatcatcaatgagcacggctttaacaggagttatgccggaaaaaacgct
gcttgttatggtaacgggacgtacttcgcggtcaatgctacttactctgccaaagacctc
tactccaaacccaatcagaatggagagaagcacatgtacctctgtcaagtgttgacaggt
gattacacccttggaaagatagggatggttgtccctccgcccaagactctcaactctgtg
gaaataatacgacagtag

DBGET integrated database retrieval system