KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00017161G001
Entry
GSTEN00017161G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
SSDB
Motif
Pfam: UPF0184 Endonuc-FokI_C EzrA HSBP1 Phage_GP20 DUF3450 Glyco_hydro_26
Other DBs
NCBI-ProteinID: CAF99171
UniProt: Q4SJL1
Position
4
AA seq 74 aa
MSGPNGDPTISAEDGIINDDDDFSSEEYEAINSMLDQINSYLDDLEERNDSLNGKLHELM
ESNRQARLEFRAQL
NT seq 222 nt   +upstreamnt  +downstreamnt
atgtctggtccaaatggggatcccaccatttcggctgaagatggtattatcaatgacgac
gatgatttcagctctgaagagtacgaagccatcaactccatgctggatcagatcaactcc
tatctcgatgacctagaagaacggaatgattcacttaatggcaaactgcacgaactaatg
gaatcaaacagacaggcccgactggagttcagggctcagctg

DBGET integrated database retrieval system