KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00017408G001Help
Entry
GSTEN00017408G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K19603  mitogen-activated protein kinase 15 [EC:2.7.11.24]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tng01001]
    GSTEN00017408G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     GSTEN00017408G001
Protein kinases [BR:tng01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   GSTEN00017408G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Bax1-I Pkinase_Tyr
Motif
Other DBs
NCBI-ProteinID: CAF99377
UniProt: Q4SJ05
Position
21
AA seq 561 aa AA seqDB search
AYGIVWKAVDRQTGETVAVKKIFDAFRNRTDAQRTFREVMFLQEFGDHPNVVKLLNVIRA
QNDKDIYLIFEYMDTGPARPVIKKGTLLKDVHKRYVMYQLLKAIKYLHSGNVIHRDQKVP
LQDLLQPSVPPDALDLLRGLLVFNPDKRLTAEQALRHPYVARFHSPAKEPALDHDVVLPV
DDAVQLSVVQYRNKLYEMMLERRTNQSMLKLIQPNHSSPGGKPSATDEEGKSSAAEDENE
DESEEQAQQRHGFVRSPAGAARHWTSAAANSGLTEPQALPPPTGGATAEMLAALVTTATC
PRLTTITTTSPTLVLKIKPSDKPSSEKCSWCSRCSFWSHSPSLPSSPLLTTPRNLFGSNP
WMCYVSYAVFLVALIVLRLLRRLPPQAPVELDRAVYLNVEPLLHGGHDRQLLRHGHRHHG
GGHHGGGLLFCCPLLATGGHSQRSHFCIVRDVQTCLKCFYFKPQSKYDFTSCRGVLFVCL
IILFLFSILCIFFRNKILHIVYSSMGALLFTCFLAVDTQLLLGNKNLSLSPEEYIFAALN
LYTDIIQIFIYILSIVGRSRE
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
gcttatggcatcgtttggaaggcggttgacaggcagaccggtgagactgtggctgtgaag
aagatctttgacgccttcaggaacaggaccgatgctcagaggacattcagggaagtcatg
ttcctccaggaatttggagatcaccccaacgttgttaaactcctaaacgtcatcagagcc
cagaatgataaagatatttacctcatctttgagtatatggatacgggacctgcacgcccg
gtcatcaagaagggcacgttactgaaggacgttcacaaacgttatgtgatgtaccagctt
ttaaaagccatcaaatatctgcattcaggaaacgtgatccacagggaccaaaaggtgcct
ctgcaggatcttctccaaccttcggttcctcccgacgccctggacctcctgagaggtttg
ctggttttcaacccagacaagcggctgacggctgagcaggcgctgcggcacccctacgtg
gcgaggttccacagtccagccaaagagccagctctcgaccatgatgtggttctgcctgtg
gacgatgccgtacaattatccgttgttcagtaccgtaacaaactgtatgagatgatgctg
gagaggaggaccaatcagagcatgctcaagctaatccagcccaatcacagcagccctgga
gggaagcccagcgccacagacgaggagggcaaaagctcagcagcagaagatgagaatgag
gacgagtccgaagagcaagcgcagcagagacatggctttgttcggagtccagctggtgca
gctcgtcactggacctcggccgcagccaacagtggactcacggagccgcaagcactgcca
ccacctacagggggcgccactgcagaaatgttggcagccctggttaccacggcgacgtgc
ccccgtcttactacgataacgacgacttcaccaactctggttttgaagataaaaccatcc
gacaagccttcatcagaaaagtgttcttggtgctcacggtgcagcttctggtcacattct
ccttcgttgccgtcttcacctttgttgacgacgccaagaaatttgttcggcagtaatccc
tggatgtgttacgtttcctatgcagtcttcctggtggctctgatcgtcctcagactgctg
cggagacttccgccgcaagcacccgtggaacttgatcgcgctgtctatcttaacgttgag
cctctcctacatggtgggcatgatcgccagcttctacgacacggacaccgtcatcatggc
ggtgggcatcacggcggtggtctgcttttctgttgtcctcttctcgctacaggtgggcac
tcacaaagatctcacttttgtatagtcagggatgtccagacttgtttaaaatgcttttat
tttaaaccacagagcaagtatgacttcacctcctgccggggcgtcctctttgtgtgcctc
atcatcctcttcctcttctcgatcctctgcatctttttccgcaacaagatcctccacatt
gtctattcgtcaatgggggccctgctcttcacctgctttttggctgtggacacccagctt
ctgctaggcaacaagaacctgtctctgagtccagaagaatacatttttgctgctctcaac
ctctacaccgacatcatccagattttcatctacatcctgtctattgtgggacgctccagg
gaa

DBGET integrated database retrieval system