KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00017635G001
Entry
GSTEN00017635G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
SSDB
Other DBs
NCBI-ProteinID: CAF99518
UniProt: Q4SIL4
Position
5
AA seq 762 aa
MDRHHKNLASSARTKANKNSNAVLHGTRCHEVSQSGEIIRPTITELTKEARTNILCTVEG
CGKILPNTPALNMHLVKSHRIKDGIVNPTVRKDMKGSQKLYCCPIEGCPRGANRPFSQFS
LVKQHFMKMHAEKKHKCFKCSNGYSTEWDLKRHIENCGKTYQCTCGCPYASRAALLSHIY
RTGHEIPTEHRFPPVKKRKMEQMSASEKAVTNEPSGQNMCSGKETADAVFAAEAAIPVSD
AAHQTSNPSKVFQKLLLPKPKMALVSVPVMQLAHLPVLLPSTDRGALSSVVLAVDPRGSV
STLQLLPQPTGAVGTQQDAKNAGYKSGSPTSHLNLRPVSTGVQANLDLAGSDATGNPALQ
RGRSTSATIQTDKSYLSKMPAGAGVGEGLSLYSVGESSVSSCSQTDISVSAQILLPVSVE
TQTWASQLKPMSSIGAQTDRHASQIPCSSAAMPPHQTRQTQTCVAVPKTEESAQDRPALG
SDLFGSDTLSVSTQTALEVGDALDSAAGMYEDAKSAAAMCFGVRSDELSSNNVADNQTQT
MTLLNDLENILSDSMSGHQVLAQAASGLAPEPEHPHGIDFDFEDFLSAAHIQTQTEESEL
AGLSGDAPLESLDIQTQTDFLLMDEVGQNRTQTSDLELFDIQTQTDLNFLLSAGTHMPLS
SILRHPSFSMSTESSHTETQTDLPSFAAGLAAQAPADGEGEHARPSNSAETQTVASHAEG
LGHLFLTSNETQTAVDDFLSADLAWNVVSHFSSVETQTCEEL
NT seq 2286 nt   +upstreamnt  +downstreamnt
atggaccgtcaccataaaaacctggcttcctctgcgaggaccaaggcgaataaaaactcg
aacgcagttctccacggcaccaggtgtcacgaagtgtcgcagtcaggggaaataataagg
ccaaccatcacggagctgaccaaagaagcgaggaccaacattctctgcaccgttgaggga
tgcggaaagattctgcccaacacgccagctctcaacatgcaccttgtaaagtcacacaga
atcaaggatggcatagtgaatcccaccgtccggaaggacatgaagggatcccagaagctt
tactgctgccccatcgagggttgtcccaggggggctaacagaccattctcccagttttcc
ctggtcaaacaacatttcatgaagatgcacgcagagaagaaacacaagtgtttcaaatgc
agcaacggttacagcaccgagtgggacctgaagagacacatagaaaactgtgggaagacc
taccaatgcacctgcggctgcccctacgccagcagagctgccctgctctcgcacatctac
aggaccggacatgagatccccacagaacacaggtttcctccagttaaaaagagaaagatg
gagcagatgagtgcttcagaaaaggccgtaaccaatgagccaagtggtcagaacatgtgc
tcaggtaaagagaccgcagacgcagtttttgctgctgaagcggcgattcccgtctcagac
gcggctcatcagacctccaacccgagtaaggtctttcagaagttgctcctccctaagccc
aaaatggctctggtcagcgttcctgtgatgcagctggcccacttgcctgtcctcctcccc
tccactgacaggggggctctgagctctgtggtgttagcggtagacccccgtggctccgtc
agcacgctgcagctgctgccacagcccaccggagcggtgggaacgcagcaggacgccaag
aatgcgggttataagagcggctcgcctacctcccaccttaacctgaggcccgtcagcacg
ggggtgcaggccaacctagacctcgcgggatcagatgctacgggcaacccggcgctgcag
cgtgggcgaagcacctcggccaccattcagacagacaaatcctacttgtccaaaatgccc
gccggagcaggcgttggggaggggctgagcttgtattcagtcggtgagtcctcggtgtcg
tcgtgctcgcagacagacatcagcgtgagtgcccagatcctcctgccggtcagcgtggaa
acccagacctgggcctcccagctcaaacccatgtcatccatcggggcccagacggaccgg
cacgcaagccagattccctgttcctccgcggccatgccgccgcaccaaacacggcaaacc
cagacctgtgtcgccgttcctaaaaccgaggagagcgctcaggaccggcccgccctgggt
tccgacctgttcggcagcgacaccctcagcgtctccacccagaccgccctggaggtgggc
gacgccctggactctgcagcaggcatgtacgaggacgccaagagcgccgccgccatgtgc
ttcggggtgaggagcgacgagctcagctcaaacaacgtggcggacaaccagacccagacc
atgaccttgctgaacgaccttgaaaacatcctctccgacagcatgtcgggtcaccaggtg
ctcgcccaggccgcctcgggcctggccccggagccggagcatccccacggcatcgacttc
gactttgaggacttcctcagtgccgctcacatccagacgcagacggaggagagcgagctg
gcgggactgagcggcgacgcgccgctggaatccctggacatccaaacccaaacagatttc
ctcctgatggatgaagtgggccagaatcgcacgcaaaccagcgatctggagctttttgat
atccagacgcagaccgatcttaatttcctgctgagcgccgggacacacatgcccctgagc
agcatcctgcgtcacccgagcttctccatgagcaccgagtcctcgcacaccgaaacgcag
acggatctcccgtcctttgccgcgggcctagccgctcaggcgcccgccgacggtgagggc
gagcacgcgcggccctcgaacagcgccgagacgcagaccgtggccagccacgcggaaggc
ctggggcaccttttcctgaccagcaacgaaacccaaacagccgtggacgactttctgtca
gcggacctggcctggaatgtcgtttcccatttcagctcggtggagacccagacgtgcgag
gagctc

DBGET integrated database retrieval system