KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00018760G001
Entry
GSTEN00018760G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K09095  hypoxia-inducible factor 2 alpha
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tng03000]
    GSTEN00018760G001
   04131 Membrane trafficking [BR:tng04131]
    GSTEN00018760G001
Transcription factors [BR:tng03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    GSTEN00018760G001
Membrane trafficking [BR:tng04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    GSTEN00018760G001
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS HIF-1 PAS_9 PAS_4
Other DBs
NCBI-ProteinID: CAG00343
UniProt: Q4SG89
Position
17
AA seq 593 aa
SNCDKDRQMDSLYLKSLEGFIAVVTSDGDMIYLSENINKFMGLTQVDLTGHSIFDFTHPC
DHEEIRENLSLRTAGKGFDKKGKEMSAERDFFMRMKCTVTTRGRTVNLKSASWKVLHCTG
QLKMYNGCPPRGLCGFREPPLTCAVLMCEPIPHPSNIDTPMDSRTFLSRHSMDMKFTYCD
ERVTELMGYTPEDLLGRSVYDFYHALDSENVTKSHQNLCTKGQAVTAQYRMLAKNGGYVW
VETQGTVIYNSRNSQPQCIVCINYILSDVEEKSTIFSLEQIESLFKPRHASRFLTEAGAG
VAAEPGDTLFTKFKEEPEDLTQLAPTPGDTIITLDFGVCRPQFEETRQEAGYSQVSAAGM
ALPDAPSWSHESLKPAPAASLKTTLPAPENMSSMPATFTMQQHPRAGSATPSLSSCSTPS
SPGDYYSPVDSDLKVELTEKLFTLDTEGHNSPANTEMDLSDLDLETLAPYIPMDGEDFQL
NPIEPLEGSVDSNSNLANTHQSFSNITSLFQPLSSPAQPQGRYQQQQPPPPTATPSAPKE
NMGSTPATVGPDDGSCMIVHIQNPPYRAPASTPLSSMGGRQNLQWPPDPLLTY
NT seq 1779 nt   +upstreamnt  +downstreamnt
agcaattgcgacaaggacagacagatggacagtctgtacctgaagtctctggagggcttc
attgccgtggtaacatcagacggtgatatgatatatctgtctgagaacatcaacaagttc
atggggctcacgcaggtggacctcactggccacagcatctttgacttcacccatccgtgt
gaccacgaggagatcagagaaaacctcagcctgaggacagcaggtaagggctttgacaag
aaaggcaaagagatgagcgctgaaagagatttcttcatgaggatgaaatgcacagtgacc
accagggggcgcaccgtcaatctcaagtctgccagctggaaggtgctgcactgcaccgga
caactaaaaatgtataacggctgtccccctcgggggctgtgcggcttcagagagcctcct
ctcacctgtgctgtcctgatgtgtgaacccatcccgcacccgtccaacattgacacgcca
atggacagcagaaccttcctcagcagacacagcatggacatgaagttcacctactgcgac
gagagggtcacagagttgatgggttacactcctgaggatctgctgggtcgatcagtctat
gacttttaccacgcactggactcagagaacgtcaccaagagccaccagaacttgtgcacc
aaaggtcaggcagtgactgctcagtatcgaatgctggctaagaacggaggttatgtatgg
gttgaaactcagggaacggtcatttacaacagtcgtaactcccagccccagtgcatcgtg
tgcataaactacatcctcagtgacgttgaggagaagtctaccattttctccttggagcaa
atcgagtccctgttcaaaccgcgtcacgcgagccgtttcctaaccgaggcgggcgccggc
gtggccgcagagccgggagacaccctgtttaccaaattcaaagaggagcctgaggatctc
acccagctggctccgacgcccggagacacaataattacccttgacttcggtgtgtgtcgc
cctcagtttgaggagacccgccaggaagcgggatacagtcaggtgtctgctgcaggcatg
gccctcccagacgctccatcctggtctcatgagagcctgaaacctgccccggctgcgtca
ctcaagaccacgcttccagctccggagaacatgagcagcatgccagccacgtttaccatg
cagcagcacccacgggctggcagtgccactccgagtctcagcagctgctccacgcccagc
agtccaggtgattactacagccctgtggacagtgacctgaaggtggaactaactgagaag
ctctttactctggacacagagggacacaacagccctgctaacaccgagatggacttaagt
gaccttgaccttgagacattagctccttacattccaatggatggagaggacttccaactg
aatcccatcgagcccctggagggatccgtagacagcaacagcaacttggctaacacacac
cagagctttagcaacattaccagcctcttccagcccttgtcctcccctgctcagcctcaa
ggtcgctatcagcagcagcagccgccgccgcccacagctacacccagtgccccaaaggag
aacatgggctccacaccagcgactgtgggccccgatgatgggtcgtgtatgattgtgcat
atccagaatcccccgtaccgggcccctgccagcacccctctttcttctatgggtggccgt
caaaacctacagtggcctccagaccctctattaacttac

DBGET integrated database retrieval system