KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00019259G001
Entry
GSTEN00019259G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04372  MAP kinase interacting serine/threonine kinase [EC:2.7.11.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00019259G001
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    GSTEN00019259G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tng01001]
    GSTEN00019259G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     GSTEN00019259G001
Protein kinases [BR:tng01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   GSTEN00019259G001
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo
Other DBs
NCBI-ProteinID: CAG00736
UniProt: Q4SF46
Position
1
AA seq 480 aa
KMVQNKITEVTGFHRSFKGQNPFESDDFTKNGSHLIDSSFNFDSPPRHDMPSSQPIDIPD
AKKRNKKKKRCRATDSFSGRFEDVYRLQEEVLGEGAYARVQTCINLITNKEYAVKIIEKG
PGHSRSRVFREVEMLYQCQGHSNILELVEFFEEEDKFYLVFEKLRGGSILAHIHKRRHFS
EQEASVVVQEIASALDFLHNKGMAHRDLKPENILCECADKISPVKICDFDLGSGIKLNSD
SSPISTPELLTPCGSAEYMAPEVVEAFSEEATIYDKRCDLWSLGVILYIMLSGYPPFVGR
CGADCGWDFGEPCHTCQVPLEPSERSGSTASPRSGFLITPFPFQNILFESIQEGKYEFPE
KDWAHISASAKDLISKLLVRDAKNRLSASQVLQHPWVRGGAFAALRMSILHQRSSNARDL
TFFAGKAMAVNRQLAEQDGMEDQHQQQQEVPFVVTASGSSMQLSPPSKSKLARRRQKSSQ
NT seq 1440 nt   +upstreamnt  +downstreamnt
aaaatggttcaaaacaagatcaccgaagtcaccggctttcaccggtcattcaaaggccaa
aatccatttgagtctgatgactttactaaaaatggatcccatcttatcgattcatcgttt
aattttgattcccctcccagacacgatatgccttctagccagcccatcgacatcccagac
gccaagaagagaaacaagaagaaaaagcgctgccgggcaaccgacagtttctctgggcgt
tttgaggatgtctacagactgcaagaagaggtactgggagaaggcgcttatgccagagtg
caaacgtgcatcaacctcatcaccaacaaggaatatgctgtcaagatcattgagaaaggg
ccgggccacagtcgcagccgtgtctttcgagaggttgagatgctctatcagtgccagggc
cacagtaacatcctggaactggtggagttctttgaggaggaagacaaattctacttggtg
tttgagaagctgagaggaggatcaatcttggcccacattcacaagagacgccacttcagc
gagcaggaagccagtgtggtcgtgcaggagattgccagcgctctggatttcctgcataac
aagggaatggcacacagagacctgaaaccagaaaatattctctgtgaatgtgcggacaag
atttccccagtgaagatctgcgactttgacttgggcagcggcatcaagctgaacagcgac
agttcgcccatctccacccccgagctccttaccccttgtggctctgcggagtacatggcc
ccggaggtcgtggaggccttcagcgaggaagccaccatctacgataagcgctgcgacctg
tggagcctcggcgtcatcctctacatcatgctgagcggctacccgcccttcgtgggccgc
tgcggcgccgactgtggctgggactttggagaaccctgccacacctgccaggtaccgctg
gaaccgtcggagcggtctggatccacagcttcgccccggtcagggtttctgatcacgccc
tttcctttccagaacattttgtttgagagtatccaggaagggaaatacgagtttccagag
aaagactgggcacacatctccgccagtgccaaagacctcatatccaaacttcttgttcgg
gatgccaaaaaccgcctgagtgccagccaggtgctgcagcacccttgggtgcgagggggt
gcatttgcggccttacggatgtccatcttgcatcagagatccagcaacgccagagacttg
accttcttcgctggtaaggccatggctgtgaaccgtcagctggctgaacaggacggcatg
gaagaccagcaccagcagcagcaggaagtcccgtttgtggtaaccgcttctggctcctct
atgcaactctcccccccctccaagtccaagctggcccggcgcaggcagaagagcagccag

DBGET integrated database retrieval system