KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00019785G001Help
Entry
GSTEN00019785G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00071  Fatty acid degradation
tng01212  Fatty acid metabolism
tng03320  PPAR signaling pathway
tng04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GSTEN00019785G001
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    GSTEN00019785G001
   03320 PPAR signaling pathway
    GSTEN00019785G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tng03029]
    GSTEN00019785G001
Enzymes [BR:tng01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     GSTEN00019785G001
Mitochondrial biogenesis [BR:tng03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    GSTEN00019785G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-ProteinID: CAG01138
UniProt: Q4SDZ4
Position
13
AA seq 802 aa AA seqDB search
MAEAHQAVAFQFTVTPDGIDLQLCHEALRQVYLSGLHSWKKRFIRFKNGVMTGVYPGSPA
GFMIVVGSYMSYNKYNRLDPSMGLVVKLGQYIPIGRYLSTDTQKIVGGVLVGTSLWVTII
MIMRNVLKSLLSWHGWMHERHGSVSWTSRAWMLLVKVFSGRKPMLYSFQNSLPRLPVPDI
SDTCRRHLESVRALMDDEQFERMTALTKDFEKNLGPRLQWYLKLKSWWASNYVSDWWEEY
IYLRGRGPIMVNSNYYAMDFLYVIPTSIQAARAGNAIHAIMLYRRKLDRAQIKPIYLLAN
KVPLCSAQWERMFNTTRIPGVETDTLQHTNETKHIVVYHKGRFFKVWMFYDGRLLLPREI
EQQMEKILADQSAPQPGEEKLAALTAGTGRTPWANARDTYFSRGKNKQALDAIEKAAFFV
TLDDTEQRYDTNNPVVSLDSYAKCLLHGKCYDRWFDKSFNLIVFKNGTMGLNAEHSWADA
PIVGHLWEQVLSMDPKNLGYTEDGHCRGAPHPNLPGPQRLQWDISTECQQVIQSSLTVAQ
KLADDVDSHIIPFSEFGKGKIKKCRTSPDAFIQIALQLAHYRDKGKFCLTYEASMTRLFR
EGRTETVRSCTVESCAFVRSMIRDETTEERLRLLKKAAEKHQNLYRLAMTGQGIDRHLFC
LYVVSKYLGEDSAFLKEVLSEPWRLSTSQTPLQQLELFDLAKHPEYVTSGGGFGPVSNPF
FWVMLAEVCICGDEWIFEFFSPAKVADDGYGVSYIILGENLINFHISSKRSSPETDSHRF
GTNIKRAMVDMLNLFELDRKTK
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagcccaccaggccgtggccttccagttcaccgtcactccagacggcatcgac
ctacagctgtgccacgaggctctacgtcaggtctacctctctggccttcactcctggaag
aaaaggttcattcgcttcaagaatggtgtaatgactggtgtgtacccaggcagccccgct
gggttcatgatcgtggtcgggtcctacatgtcgtacaataaatataatcggctggatcct
tctatgggtttagtggtcaagctgggccaatacatacccatcggtcggtatctgtcgacc
gacacccagaagatcgtcgggggagtgttggtgggcaccagcctgtgggttacaataatc
atgatcatgaggaatgtcctgaagagtctgctgtcctggcacggttggatgcacgagcgc
catgggtctgtgtcctggacttctcgagcatggatgctgctggtgaaagtgttttctggg
aggaaaccgatgctctacagtttccagaactccctgccgagactgcctgttccagacatc
agcgacacttgcagaaggcatctggagtcagtgcgtgcactgatggacgacgagcagttt
gaacgtatgacagccctgacgaaggactttgagaaaaacctggggcccagactgcagtgg
tacctcaaacttaaatcctggtgggcctccaactatgtgagcgactggtgggaggagtat
atttacctcagaggtcgcggccccatcatggtgaacagtaactattatgcgatggatttt
ttgtacgtaatcccaacttccatccaggctgcccgggcaggtaatgccatccacgctatc
atgctctacaggaggaaactggacagagcccagatcaaaccaatatacttgctggcaaac
aaggttcctctgtgttcggctcagtgggagcggatgtttaacaccacccgcatccccggt
gtggagacagacacccttcagcacacgaatgaaaccaagcacatagttgtgtatcacaag
ggccgctttttcaaggtgtggatgttttatgatggccggctcctgcttccacgagagata
gagcagcagatggaaaagatcctggccgaccagtcggcgccccagccaggggaggagaag
ctggcagcactcaccgcaggaacaggtaggacgccctgggccaatgctcgtgacacttac
ttcagccgcggtaagaacaagcaggctctggatgccattgagaaggcagccttcttcgta
accctggacgacacagagcagcgctatgacaccaacaacccggttgtgtctctggacagt
tacgccaagtgtctgcttcatggaaagtgctatgacaggtggtttgataaatcatttaac
ctgattgttttcaaaaatggcaccatggggctgaatgcggagcattcctgggccgacgct
cccatcgtcggtcacctgtgggagcaagtgctgtccatggatcccaaaaacttgggctat
actgaggatggccactgccgtggggccccccaccccaacctgccaggtcctcagaggctg
cagtgggacatctctactgagtgccagcaggtcattcagtcctcccttacagtggcccag
aagctggctgatgatgtggactctcatattattcccttctctgaatttggaaaaggcaag
ataaagaagtgccggaccagtcccgatgccttcatccagattgccttgcagctggcccat
tacagggacaaaggaaagttctgtcttacgtacgaagcctccatgacacgtttattccgc
gagggccggactgaaactgtgcgctcctgcaccgtagagtcctgtgcctttgttcgctct
atgatcagagatgaaacgacagaagaacgtctcaggttgctgaaaaaggcagcggaaaag
caccaaaatctgtaccggctggcgatgacaggacaaggcattgaccgtcacctcttctgt
ctgtatgtggtctctaaatacctgggagaagactctgccttcctcaaggaggtcctgtct
gagccctggaggctgtccaccagccagactcccctccagcagctggagctctttgacctg
gccaaacaccccgagtacgtaacatccggcggtggttttggtccggtaagtaatcctttc
ttttgggtaatgcttgcagaggtgtgcatttgtggggatgagtggatttttgaattcttt
tcacctgcaaaggtggctgatgatggttacggtgtctcctacatcatcttgggtgagaat
ctgatcaacttccacatctccagcaaacgctccagcccagaaactgactcccaccgtttt
ggcaccaacatcaaacgcgccatggtggacatgttgaacctctttgagctggacaggaaa
accaagtga

DBGET integrated database retrieval system