KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00021008G001Help
Entry
GSTEN00021008G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00020  Citrate cycle (TCA cycle)
tng00640  Propanoate metabolism
tng01100  Metabolic pathways
tng01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GSTEN00021008G001
   00640 Propanoate metabolism
    GSTEN00021008G001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tng04147]
    GSTEN00021008G001
Enzymes [BR:tng01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     GSTEN00021008G001
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     GSTEN00021008G001
Exosome [BR:tng04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GSTEN00021008G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: CAG02043
UniProt: Q4SBD9
Position
11
AA seq 431 aa AA seqDB search
MAASMASQAAVRGLRAATSKHILLDKLKGSWSTPRRWLNLQEYQSKKLMQESGVAVQRFY
VADTASDALEAAKKLNAKEIVLKAQILAGGRGKGVFDSGLKGGVHLTKDPAVVGDLASKM
LGFNLTTKQTPQEGVKVKTVMVAEALDISRETYFAILMDRSYNGPVMVGSPQGGVDIEEV
AASNPELIFKEVIDIFEGVRDDQALRMAVNLGFKGVLQRQAADQIKRLYDLFLKVDATQV
EVNPFGETPEGQVVCFDAKINFDDNAEFRQKDVFAMDDMSESDPTETEAAKWGLKYIGMD
GNIACFVNGAGLAMATCDIIDLHGGKPANFLDLGGGVQERQVYEAFKLLNADPKVEAILV
NIFGGIVNCAIIANGITKACRELQLKVPLVVRLEGTNVHEAKRILRESGLPITAAEDLDD
AAMKAVAAIRK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atggctgcatccatggcatcacaggcggccgtaagaggattgagggctgcaacctctaaa
catatactcctggacaaacttaagggaagttggtcgactccaagaagatggctgaaccta
caggagtaccaaagcaagaagctgatgcaagagagtggcgtggccgtccagcgtttctac
gtggccgacacggcttctgacgccctggaggctgcaaagaagctcaacgccaaggagatt
gtgctgaaagctcagattctggctggcggcagaggcaaaggcgtgtttgacagcggccta
aaaggcggcgtgcacttaactaaagacccggccgtggtcggtgatctggccagtaagatg
ctgggtttcaacctgacaacaaagcagacgccgcaggagggagtgaaagtgaaaacggtg
atggtggccgaggctctggacatcagcagggagacctactttgccatcctaatggaccgg
tcctacaatggcccggtcatggtaggcagcccacaggggggtgtggatatcgaagaggtc
gccgccagcaacccggagctcatctttaaggaagtgattgatatctttgaaggtgtgcgt
gatgaccaggcactacgcatggcagtgaatttgggcttcaaaggagttctgcagagacag
gcagccgaccagattaagaggctctacgatctgttcctcaaagtcgacgccactcaagtc
gaagtcaatccttttggagagacacctgaaggacaagtggtttgctttgatgcaaagatc
aactttgatgacaacgccgagttccgccagaaagacgtgttcgccatggacgacatgagc
gaaagcgaccccacggagacagaagcggcaaagtggggcctcaaatatatcgggatggat
ggaaacatcgcctgtttcgtgaatggagctggtctagctatggccacttgtgacatcatt
gatctccacggggggaagccggccaactttctggacctggggggcggcgttcaagagagg
caggtgtacgaggcttttaagctgctcaatgctgaccctaaggtcgaggccatcttggtg
aacatttttggtgggatcgtcaactgtgccatcatcgccaatggaatcaccaaggcctgt
cgagagctgcagctgaaggtgcccctggtggtcaggttagaagggaccaacgtgcacgag
gccaagcggatcctgagggagagcggcctgcccatcacagcggcggaggacttggacgac
gccgctatgaaagcggtggccgccatcaggaagtag

DBGET integrated database retrieval system