KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00021890G001Help
Entry
GSTEN00021890G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00500  Starch and sucrose metabolism
tng01100  Metabolic pathways
tng04910  Insulin signaling pathway
Module
tng_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    GSTEN00021890G001
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    GSTEN00021890G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tng01003]
    GSTEN00021890G001
Enzymes [BR:tng01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     GSTEN00021890G001
Glycosyltransferases [BR:tng01003]
 Polysaccharide
  Storage polysaccharide
   GSTEN00021890G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4
Motif
Other DBs
NCBI-ProteinID: CAG02715
UniProt: Q4S9G7
Position
undetermined
AA seq 269 aa AA seqDB search
MLDKEDFTIMKRAIFATQRQCQPPICTHNMLEDASDPILNCVRRIGLFNSSADRVKIIFH
PEFLSSTSPLLPMDYEDFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFM
EEHIADPSAYGIYILDRRFRGVDESCNQLTSFLFQFCKQSRRQRIIQRNRTERLSDLLDW
RYLGRVGLPNPLAIIMYLRATWPWLKRFLKSTSMNLMSRQRPRASATPDRRPCPRPRPCL
ATPLPTTAKLRTTTKRNAMTRTWRQRRTG
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgctggacaaagaggacttcaccataatgaagcgcgccatctttgccacgcagagacag
tgccagccccccatctgcactcacaacatgctggaggacgccagcgaccccatcctgaac
tgtgtccgacgcatcggcctcttcaacagctctgccgaccgcgtcaaaattattttccat
ccggagtttctttcatccacctctcctctacttccaatggattatgaggactttgtacga
ggttgccacctcggcgtcttcccctcttactatgagccttggggctacacgccagctgag
tgcacagtcatgggaatcccgtcagtctcgaccaacctgtcgggctttggctgtttcatg
gaggaacacatagcggacccctcagcttatggtatttacatcctggaccggcggtttcga
ggggtcgacgagtcctgcaatcagctcacttcgttcctgtttcagttctgtaagcagagc
cggcgccagcggatcatccagaggaaccgaactgagcgcctgagcgacctcctggactgg
cgatacctcggcagagtaggcctccccaacccgctcgccattattatgtatctgcgcgcc
acatggccctggctaaagcgtttcctgaaatctaccagtatgaacttaatgagccgacaa
cgacctcgggcttccgctaccccagaccggcgtccgtgcccccgtccccggccctgtctc
gccactcctctccccaccacagcgaagctgaggacaacgacgaagaggaatgctatgacg
aggacctggaggcagagaaggacagggtga

DBGET integrated database retrieval system