KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00023139G001
Entry
GSTEN00023139G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K09100  single-minded
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tng03000]
    GSTEN00023139G001
Transcription factors [BR:tng03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    GSTEN00023139G001
SSDB
Motif
Pfam: SIM_C PAS_3 PAS_11 PAS HLH
Other DBs
NCBI-ProteinID: CAG03650
UniProt: Q4S6T2
Position
14
AA seq 695 aa
MKEKSKTAARTRREKENSEFYELAKMLPLPSAITSQLDKASIIRLTTSYLKMRIVFPQGL
GEAWGHTSRTRPLDNIGRELGSHLLQTLDGFIFVVAPDGKIMYISETASVHLGLSQVIHC
SGYLKIRQYSLDMSPFEGCYQNVGLVAVGHSLPPSAVTEIKLHSNMFMFRASLDMKLIFL
DSRVAELTGYEPQDLIEKTLYHHVHSCDIFHLRCAHHLLLVKGQVTTKYYRFLAKHGGWV
WVQSYATIVHNSRSSRPHCIVSVNYVLTDTEYRGMQLSLDQMSPTKPAFPYADCHAEDRK
STKSRPTPAKAKIRVSPYPQFSAFNPERSESDQDSQWGGSPLTDSASPQLMDPVEAPETS
CAYRLYPDSGSLCYSLGLSEEELSHASSHPHTTTCDRVRCQSSRYFLGTPQSGREVWWDA
TRSMLSLPKSSMESSGSYEITSYHGAIHGRGHWDEDSVVSSPDGGGSTSDSGDRHHADHF
RATPREPSKMETLIRATQQMIKEEETRLQQHKEPVEILGLSKAHSPCFTSSLGHHSQLTM
PSVVCRGPGAPSIDPPSERLHHRDIIKGLGSHDNDENTNSPASLSRLSSPSSDGIPRSSL
SLTKDYMQTDLSPHPPQPQGSPLIYPPQERQHLDRQAAYALAGYSLEHLYDAESLRSYSG
LACGGVQYDVASHVRMQAEQMQGHKATSVIITNGS
NT seq 2088 nt   +upstreamnt  +downstreamnt
atgaaggagaaatccaaaacggccgcaaggactagacgggaaaaagagaacagtgaattt
tacgaactggcgaaaatgttgccgctaccgtcggccatcacctcccagctggataaagcc
tccataatacggctgacgaccagttacctgaagatgaggattgttttccctcagggttta
ggtgaggcctggggacacacaagtcgaaccagacctttggataacattgggagagagctg
gggtctcatttgctgcagacgctggacgggtttatctttgtcgttgcccccgatggaaaa
atcatgtacatttcagagacggcgtcggtgcatctgggactgtctcaggtgatccactgc
agcggctacctgaagatccgccagtacagtctggacatgtcgcccttcgagggctgctac
cagaacgtgggcctggtggccgttggtcactccctgcccccgagcgctgtgaccgagatc
aagctgcacagcaacatgttcatgttccgagccagcctggacatgaagctcatctttctg
gactccagggtggcggagctcacgggttacgagccgcaggatctgatcgaaaaaaccctg
taccaccacgtccacagctgcgacatcttccaccttcgctgtgcacaccacctcttgctg
gtaaaaggccaagtcaccactaagtattaccgtttcctcgcgaagcacgggggctgggta
tgggtccagagttacgctacaatcgtccacaacagccgctcgtccagacctcactgcatc
gtcagcgtcaattacgtcctcacggatactgaatataggggaatgcagctctccttggac
caaatgagccccaccaagccagcttttccatatgcagactgccacgctgaggacaggaag
agcaccaaatcacgtccaactccggctaaagccaaaatcagagtgtcaccctacccacag
ttttcagctttcaatccagagcgctccgagtcggaccaagacagccaatggggagggagt
ccactgacagactctgcgtctcctcagctgatggatcccgttgaggccccagagacatct
tgtgcttatcgactgtatcccgactcgggctctctgtgctacagcctggggctgtcagag
gaggaactctcccatgcgtcgtcacatcctcacacaactacctgtgaccgagtgagatgt
caaagcagccgctactttctaggaaccccccagtcaggacgagaggtctggtgggacgca
acaagatctatgctttcgttgccaaaatcatccatggagagcagtggaagctacgaaatc
acatcctaccacggagccattcatggacggggccactgggatgaagacagtgtggtgagt
tcgcccgatggcggtggctccacgagcgactctggtgaccgtcaccacgcagaccacttc
cgagcaacccctcgagagcccagcaagatggagaccttgatccgagccacgcagcagatg
atcaaggaggaagagactcgtctgcagcaacacaaagagccagtagaaatcttgggactt
tctaaagcacacagcccgtgcttcacctcctcgctcggccaccactcccagcttaccatg
ccgagcgtggtctgccggggtcctggtgctccgagcatcgaccccccctctgaacgcctc
catcaccgggacatcatcaaagggctcggttcacacgacaatgacgagaacacaaacagc
cctgcgtctctgtcccgtctcagcagccccagctcggacgggatacccaggtcaagcctt
tccctcaccaaagactacatgcagacggatctgtcgccacacccgccgcagccccagggc
agcccgttgatctacccaccccaggagaggcagcacctggacagacaggcagcttacgct
ttggctggctactccctggagcacctgtatgatgcagagagcctgcggagttactcaggc
ctggcttgtgggggggtgcagtacgacgtggcgtcccacgtgaggatgcaagcggagcag
atgcagggacacaaggccacctcagtcatcataaccaatggaagttga

DBGET integrated database retrieval system