KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00024408G001Help
Entry
GSTEN00024408G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K00453  tryptophan 2,3-dioxygenase [EC:1.13.11.11]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00380  Tryptophan metabolism
tng01100  Metabolic pathways
Module
tng_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    GSTEN00024408G001
Enzymes [BR:tng01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.11  tryptophan 2,3-dioxygenase
     GSTEN00024408G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_dioxygenase
Motif
Other DBs
NCBI-ProteinID: CAG04628
UniProt: Q4S404
Position
20
AA seq 444 aa AA seqDB search
MSKCPYFDKKHLLFKREETVGEDEDAAQAGINNASKGGIIYGDYLQLEKVLSSQVLQSEL
KGGKIHDEHLFIVTHQAYELWFKQILFELDSVRDIFISGHVRDERNMLKVNTRIQRIVMI
FRLLIDQFAVLETMTALDFFDFREYLSPASGFQSLQFRILENKIGILDRLRVTYNRRHYR
DNFKGQESETLNTTEQEPSLLRLVEEWLERTPGLEADGFNFWEKLEINIFRGLNQEKEKI
EKMSESEEKEELRLELAKQMDVFTSLFDEKRHDHLLSKGERRLSYKALQGALMIYFYREE
PRFQVPFQLLTFLMDIDTLMTKWRCKHLCATISFCSILPLKRESSALMKCPTMSKHTLNM
HLPRISENHVCMVHRMIGSKCGTGGSSGYHYLRSTVSDRYKVFVDLFNLATFLVPRHWIP
KLNPNIHTFLYMAECNDSSYCSED
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaatgtccatactttgacaagaagcacttgttgttcaaaagagaggagactgtg
ggagaggatgaggatgccgctcaagcaggaattaataatgccagcaaaggaggaattatc
tacggagactacctccagcttgaaaaagtcctcagtagccaggttctgcagagtgaatta
aagggtggaaagatccatgacgagcacctcttcatcgtcacccatcaagcctatgaactg
tggttcaagcaaattttgtttgaacttgactcggtgcgcgacatctttatcagcggacat
gtccgagatgagcgcaacatgcttaaagtcaacacacgcatccaaaggatcgtgatgatc
ttcagactgctgattgaccagtttgcagtgttggaaacgatgacggcgttggactttttt
gacttcagggaatacctgtctcccgcctctggattccaaagtcttcagtttcggatcctt
gagaacaaaatcgggatcttagaccgtctgagggtcacatacaacaggcgtcactacagg
gacaatttcaagggtcaagaaagtgagacgttaaacaccaccgaacaggagccatcgctc
ctgagactcgtcgaggaatggctagagagaacaccaggattggaggcagatgggttcaat
ttctgggaaaagctggaaatcaatatatttagaggattgaatcaggagaaagaaaaaatt
gagaaaatgtccgagtcggaggagaaggaggagctaaggttggagctggccaaacagatg
gatgtcttcacatctctgtttgatgaaaaacgtcatgaccacctccttagcaaaggtgag
agacgcctctcttacaaggctcttcaaggtgccttgatgatctacttctacagggaagag
ccaaggttccaggtccctttccaactgctgacattcctcatggatatcgacaccctcatg
acaaaatggagatgtaagcatttatgtgctacaatttctttttgtagcattctgccactg
aaaagagaaagtagcgctttaatgaaatgcccaaccatgtcaaaacacactttaaatatg
catctgcctcgtatttcagaaaatcacgtttgcatggtgcatcggatgattggcagcaaa
tgcggtacaggagggtcatcaggctaccactacctgagatctacggtcagcgaccgctac
aaagtgtttgtggatctctttaacctggccacattcttggtgcctcgccactggatccct
aagttaaatcccaacattcacactttcctttacatggctgaatgtaacgacagttcatac
tgcagtgaggac

DBGET integrated database retrieval system