KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00025091G001
Entry
GSTEN00025091G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tng01002]
    GSTEN00025091G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     GSTEN00025091G001
Peptidases and inhibitors [BR:tng01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   GSTEN00025091G001
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin Reprolysin_3 TSP1_CCN Reprolysin_4 TSP1_spondin Reprolysin_5 Reprolysin_2 ADAM_spacer1 Peptidase_M10
Other DBs
NCBI-ProteinID: CAG05166
UniProt: Q4S2G6
Position
undetermined
AA seq 1518 aa
MFSKLLSCILLLQPGFITLLVSSSSSEPSHLLSSQKEDVSSFNFFPDDSGRGRLPRSVLM
PDVSHLELLVVVGPDVQQVHKQDTERYILTNLNIVNTKLLRDMTLGANMRVHLVHMVALS
EPDPEIQLSANITSSLRSVCEWGRKINPSNDSDPLHADLLLYITRYDLVLPDGNKQVRGV
AQLGGACSSEWSCVIAEDTGFDLGITIAHEIGHSFGINHDGVRNTCSKSGFIMASDGGYN
SVDLTWSPCSRQQLLAFFSDGRAECVKDLPALGGSMQDWKPGLYYGVDDQCRIAFGSSAR
ACSFSNADLPTCRTLSCHVNPHDDSSCKRLLVPLLDGTECAPHGWCLKGRCVLMDELSSS
VVVHGSWSSWSQFSPCSRTCGGGITHRTRKCTNPRPAFGGKDCEGTDVEAELCHQQRCEN
RTQLDFIAEQCSKTDAQALYLLPKSASFYTWIPAVGFTQGGLREIPINMQVKAVTWQTVL
HLPQPGEEQCRYLCQSDGENFLVSRGSQFVDGTRCESDSPPPFGSIAACLRGTCQLFGCD
GTLRSGRARDVCGVCEGNGSSCSLISGSYTAGQARAYTTFLSVPVNATQVHIINRAPLFT
HMAVLLGSQYVVSGRGTMALNVTYPSVLDEDRLEYRLYLTPDLLPEMEELLMPGPLHEEV
HVQVYRKYGKEYGEKTNPNISYQFYVPGSSKDVTNSRPKGRWAFVTTPCSVSCGSGVQTH
VRVCTDENTKKHLEDDSCEAPPVTPPPTPCQRPPCPPRWDTGPFGPCSTSCGGGEHERLV
RCVQTLGRAEVQVPNSECPAETAPHSVEKCNLQHCPARWQVSEPGECSAICGPGEAKRVV
SCVRPENGQYVKVDEVFCQKQSRPEDSVPCVVDVCPIGWESKGEVKQTSAEKRSGLLTDP
KQDPVYVWSPVVSKCSKTCGNGTLQLWFSCVDHQTRLGVADFYCDASTKPPLQSESCNAS
PCPPTWRFKQGVCSVTCGGGLANRVLYCGREAEGEEEVLENSECSHSAKPTAVVSCNSHS
CPARWKVRRTSPCSVSCDLGIAQRTVSCVQFVNGTESAVAEANCHSVVRPATTVPCLVQV
CTFRWEVQEWSQVQPTARSFVETHKSTMHVKFFDLNVMSVERLDILFFSDISFLLTFVLK
TLQCSVSCGYGIQSRVVSCMGPSQPQPLSPLLCMHMPKPITIQSCSVGNCRDASLRPTYR
SGPPGPTKASASLQNIPTSIPSAKTSQHTDLRIPQFFSDSSQRCVSPDACGRLLLEPSGT
VDLSGVNGQCTVFIGRPLDEVIYVKIESGSLDCKLQKEYVLFFDRLALVRKCKQLTGAEL
TTRTNVLLVRQRLLTPGNGVTFTYTSQKNTKRSHHWGQNPSAFERGGVRHLTLAPHYISP
LGRLRRSAVLAEWRLREPDNFPLQPQLQGPHQCPSLGEDPGPSAARWFQLHQLPVDIHHD
QGHGHVKDHRVQRPSAVSLALVWKHGRGGISWRIPAIQRELQSRIFLCVPLIFNSLLMTV
PRFFEVYCAYVHVFILLA
NT seq 4557 nt   +upstreamnt  +downstreamnt
atgttttccaagcttctgagctgtattctcttgctgcagcctggcttcatcactctgctg
gtttcttcttcttccagcgagccctcccatctcttgtccagtcagaaagaagatgtctcc
tcttttaatttctttcctgatgactcagggaggggacgtttgcctcggtcggttttgatg
ccggacgtttctcatctggagcttcttgtggtggttggacctgatgtccagcaggtccac
aagcaggacacggagcgatacatcctcaccaacctcaacattgtaaacacaaagctgctg
agagacatgaccctgggcgccaacatgagggtgcacctggtccacatggtcgccctgtca
gagccagatccagagatccagctgtcggccaacatcacatctagtctcagaagtgtgtgt
gagtggggccggaagatcaacccctcaaatgattcagaccctctccatgctgatcttctt
ttgtacattacaaggtacgacctggtgttgcccgatgggaataaacaggtccgaggcgtg
gcacagctgggtggagcttgcagtagcgagtggagctgtgtgatcgccgaggacacgggg
ttcgacctggggatcaccatcgctcatgagattggtcacagttttggaatcaaccatgat
ggagtgagaaacacctgcagcaaatctggcttcatcatggcgtctgatggtggctacaac
agcgtggatctgacctggtccccgtgcagccgacagcagctgctcgcattcttcagtgac
ggcagagctgagtgtgtgaaagacctccctgctctgggaggctccatgcaggactggaaa
cctggtctgtattacggcgtcgacgaccagtgtcggatagctttcggaagctctgctcga
gcctgttccttctccaacgctgacttgccgacttgtcgtactctgtcttgtcacgttaac
cctcatgatgacagctcatgcaaacgtcttctagttccactgctggacggaacagaatgt
gcacctcatgggtggtgtttgaagggccgttgtgttttgatggatgagctgagctcctct
gtggtggtgcacggctcctggtccagctggtcccagttttcaccttgttcccggacctgc
ggtggaggaatcactcatcgcacacgcaaatgcaccaatcctagacctgcatttggcggc
aaagattgtgagggaacagacgttgaagctgaactttgtcaccagcagcgatgtgaaaac
agaactcagctggacttcatagcggaacagtgttcaaaaacagacgcccaggctctctac
ctgctacctaagagcgcctccttctacacctggatccctgctgtgggcttcacacaaggt
gggctcagagagattcctataaacatgcaggtgaaagctgttacctggcaaactgtcctc
catctaccacaaccaggagaggagcagtgcagatacctgtgccagtcagatggagagaac
ttcctggtgagtcgcggctctcagtttgtggatggaactcgctgcgagtccgacagtccg
cctccgtttggctccatagctgcttgtttgagaggcacgtgtcagctgtttggctgtgac
ggcacgctgcgctctgggagggcgagagatgtctgtggggtgtgtgagggaaatggatca
tcctgcagtttgatatcgggatcttacactgccggccaagccagagcatacaccaccttc
ctctccgtgccggtgaatgcaacacaagttcatatcatcaacagggcgccgctcttcact
cacatggctgtattgttgggaagtcagtacgtcgtgtctgggcggggcaccatggcctta
aacgtgacctacccatccgttctggatgaggaccgccttgagtatcgactttacctgacc
cctgaccttttgcctgaaatggaggagctgctgatgcctggacctctgcacgaagaggtg
catgtacaggtctatcggaaatatggaaaagaatacggggagaaaacaaatccaaatatt
agttatcagttctatgtacctggatcatccaaagatgtgacaaacagcagacctaaaggc
agatgggcatttgtgacaacaccctgctctgtgtcctgtggatcaggagtgcagacacac
gtccgtgtttgcacagatgaaaataccaaaaaacacttggaggacgacagttgtgaagca
cctccagtcacaccgcccccgacaccctgtcaacgtcccccctgtccccccagatgggac
acaggcccgtttggaccctgcagtacctcctgtgggggaggagagcatgagcgcctcgtg
agatgtgttcaaaccctcggaagagccgaggtgcaggttccaaattccgaatgtccagca
gaaacggctccacactctgttgaaaagtgtaacttgcaacactgccctgccaggtggcag
gtgtcagaaccaggagaatgctctgccatttgtgggccgggagaagccaaacgcgtcgta
tcgtgtgtgcgtccagaaaacggacagtatgtcaaagtggatgaagtcttttgccagaaa
cagagcagaccggaggattccgtgccgtgcgtggttgatgtgtgtcctatcggatgggaa
tcaaagggagaagtaaagcagacatcggccgagaaaaggtctgggctgctcacagacccc
aaacaggatcccgtgtatgtgtggagccccgttgtcagcaagtgctcaaagacttgtgga
aacggaaccctccagctgtggttttcctgcgtggaccaccagaccagacttggggttgca
gacttctactgtgacgcttctaccaaaccgcctcttcagtctgagagctgtaacgcgtct
ccctgccctccaacgtggcgcttcaagcaaggagtgtgcagtgtaacgtgcggaggaggg
ctggccaacagagtactgtactgtggaagagaggcagaaggagaggaggaggtgttggag
aattcagagtgcagccactcggccaaacccacagcagtggtttcgtgcaacagccacagc
tgcccagcaagatggaaggtgcggaggacgtcaccctgctcggtgtcctgtgatcttggc
attgctcagaggaccgtgtcttgtgtccagttcgtcaacggtacagagagcgcagtggcg
gaggcaaactgccactctgttgtcagaccggccaccacggtgccctgcctggtgcaggtc
tgcaccttcaggtgggaggtgcaggagtggagccaggtacagcccacagcacggtcattt
gtggaaacgcacaagtccaccatgcatgtcaagttctttgatctgaatgtgatgtccgtg
gagcgtttggacatcttatttttttccgatatttctttcttgctgactttcgttttaaaa
accctccagtgttcagtttcctgtggatatgggatccagtccagggtcgtgtcctgcatg
gggccctcgcagccgcagcctctcagccccttgctgtgcatgcacatgcccaagcccatc
accatccagagctgcagcgtggggaactgcagagacgcatcgctgcggcccacatatcgc
tctggtcctccgggtccaacgaaggccagcgccagcctccagaacatcccgacctctatc
ccatccgccaagacaagtcagcacacagacctaagaatcccgcagttcttctccgactca
tcacagcgttgtgtttcaccagatgcgtgtggacggcttctcctggagccatcgggcact
gtggacctgagcggcgtgaacggacagtgcaccgtgttcattggtcggccgctcgatgag
gtcatctacgtcaaaatagaatccggctccttggactgcaaactgcaaaaggagtatgtg
ttgttttttgaccgcctggcattggtgaggaagtgcaagcagttgacaggagccgagctg
accacgcgaaccaacgtcctgctggtccgccaacgcctgctgacccctgggaacggggtc
acctttacttacacgtcgcagaagaacacgaagaggagccatcattggggtcagaatccc
agcgcgtttgaacgcggcggggtgcgtcacctgacgctagcgcctcattacatctctccg
ctcggcagactgcgacgttcagctgttctcgccgagtggcgtcttcgagaacccgacaac
ttcccactccaaccacagctgcagggtcctcatcaatgcccctccctcggtgaagatcca
ggtccaagcgctgcacgttggtttcaactccaccagctcccggtcgacatacatcatgat
cagggacatggacatgttaaagaccaccgtgttcaaaggccatcagctgtttctctggcg
ctcgtctggaaacatggccgaggtggaatttcatggagaatacctgcgatccaaagggag
cttcagagcagaatattcctttgtgtcccattgatatttaactcattattaatgaccgtt
cctaggttctttgaggtttattgtgcttatgtgcatgtgtttattcttttggcctga

DBGET integrated database retrieval system