KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00026516G001Help
Entry
GSTEN00026516G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K13915  lysozyme C [EC:3.2.1.17]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tng04147]
    GSTEN00026516G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     GSTEN00026516G001
Exosome [BR:tng04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GSTEN00026516G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lys SLT
Motif
Other DBs
NCBI-ProteinID: CAG06232
UniProt: Q4RZF0
Position
undetermined
AA seq 173 aa AA seqDB search
MRHKVHSNGGAALAAPGRLASVRRLAAAAAMRTLVFLLLLAVASAKVYQRCELARVLKSQ
GMDGYRGISLANWVCLSKWESEYNTNAINHNTDGSTDYGIFQINSRWWCNNDVTPTSNGC
NIKCRALLTDDISVAIACAKRVVRDPQGIRAWVAWRNRCQGRDLSGYVAGCGL
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgaggcacaaagttcacagcaacggaggagcagcgttagcggcgccaggacgcctagcg
tccgtcagaaggctagcagcagcagcagcgatgaggactctggtgtttctgctcctgttg
gctgtggccagcgctaaggtctaccagcgctgtgagctggcccgagtgctgaagagccag
gggatggatggctaccgagggatcagcctagccaactgggtctgtctgtccaagtgggag
tccgagtacaataccaacgcgatcaaccacaacaccgatggttccaccgactacggcatc
tttcagatcaacagccgctggtggtgcaataatgatgtgaccccgacaagcaacgggtgc
aacatcaagtgcagggcgctcctgactgatgacatcagcgtggccatcgcctgtgccaag
cgtgtggtcagagatcctcaaggcatcagggcctgggttgcgtggagaaaccggtgccaa
ggacgcgatctgagcggctacgttgcaggatgtggcctttga

DBGET integrated database retrieval system