KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00026968G001Help
Entry
GSTEN00026968G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tng01001]
    GSTEN00026968G001
   01009 Protein phosphatases and associated proteins [BR:tng01009]
    GSTEN00026968G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     GSTEN00026968G001
Protein kinases [BR:tng01001]
 Serine/threonine kinases: Other
  Wnk family
   GSTEN00026968G001
Protein phosphatases and associated proteins [BR:tng01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GSTEN00026968G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: CAG06563
UniProt: Q4RYG9
Position
2
AA seq 1138 aa AA seqDB search
MLHHLPCLPLSPGWTRLPAGFALLRSRSSGEIRVPRVHVCASGGLGGGFVVKQRKVLLRQ
IRCRRCYLQGLRPSASGEFGGYVLTRKLTKAERQRFSEEVEMLKCLQHPNIVRFHDSWKS
TVKGHKCIILVTELMTSGTLKTYLKRFKEMKLKLLQRWSRQILKGLHFLHTRTPPIIHRD
LKCDNIFITGPTGSVKIGDLGLATLKSASFAKSVIGTPEFMAPEMYEEKYDEAVDVYAFG
MCILEMATSEYPYSECQNAAQIYRKVTSGNKPDSFYKVKVPELKEIIGGCIRMNSDERYT
IQDLLDHPFFQENNGVHVELAKEDDMVKSGLKLWLRMDDTKKLHGKYKDNNAIEFLFELY
KDVPEEVAQEMVVLGFVCEADFKIVAKAIRDRVTAIKRQREKLRKQAEEHKKKQQREAIE
EEAEAPPVSPQVSEAVPAESPPPALTPLAPILSPVTSSVDSGVSSSYPAEPEEPEADQHF
HMRHNSLSSANSDCETDGYLSSSGLQDPLEAGGFNTQATPPATCKEGPPTANGFPVPALR
FPSVSDLDGGIATCPCSYASDVASGLSDGYEGLSEKNEKTAARRTAGKVFRRRARSRLRI
TGLSDKVDRVVECQLQTHNDKMVTFKFDLDGDNPEDIAAVMMNLQTFVSLCLIDSRTRCD
ADTKLKMFLFEKIQTCHFAFKVHNEFILPSEKEGFIYRMGDIIKRAESLMAKGQPGHSSG
HRMAPPAFHSGANSLSSSQVAALAVLRLLVSSVKKAHVSCTCVLPAYLYSHTHPRTSFSS
SLPGSPLHHHHHYYPASLLPQHQHYHSPYSHFPFPYPGSPESPKPAHHPTLTRVASNPTF
PSVHSPVPGSQSPLHEAPRPGSSDSITLTPPGTQPPNMWPPHTQPLFSLANVISMAMSMA
QSFIPPTGLTTQGMISYPGFHPQMPAPIPPQTGYPSVYPPHYHSPPGEFSYPAVGIPAPN
NIYHRPKPPMENLAPPGNLTWQPPVSPPSMASTPPLAPQEQQAGPSSPPGHIQGDQGQAP
PHTAQVQTQTELRSRKRNRRRAYSLSLLGTSADSGLSVTAAELEGRLWDGAAGSPQYSNA
LHHLWMMTYSRSTPYLSSDDSDSDEEEILEELQGLREKHLTEVQTLQAAQKKEIEDLY
NT seq 3417 nt NT seq  +upstreamnt  +downstreamnt
atgctgcatcaccttccctgcctgccgctgagcccgggctggacccggcttccggcgggc
tttgctctgctcagatctcgctccagtggtgagatcagagttccccgtgtgcacgtttgt
gcatcaggtgggctcggtggaggctttgtggtcaagcagaggaaagtcctgcttcgtcag
atcagatgccgccggtgttacctgcagggcctccgaccgtcagcgtctggggagtttggg
ggttatgtcctgacccgtaagctgaccaaggcggagcggcaacgtttcagcgaggaggtg
gagatgctcaagtgcctgcagcaccccaacatcgtccgcttccacgactcctggaagtcg
acggtgaagggccacaaatgcatcatcctggtgacggaactcatgacgtcgggcacgctg
aaaacctacttgaagaggttcaaggagatgaagctaaagctgctccagcgttggagtcga
caaatcctgaaggggctccacttcctgcacacgcgaacgcctcccatcatccacagggac
ctgaagtgtgacaacatcttcatcacgggccccactggctctgtcaagattggggacctg
ggactcgccactctaaaaagtgcctcttttgctaaaagtgtcattggaaccccagagttc
atggctccagagatgtacgaggagaagtatgacgaagcggtggatgtctacgccttcgga
atgtgcatcctggagatggccacctccgagtacccgtactccgagtgccaaaacgccgcc
cagatctaccgcaaagtcactagtggaaataaaccagacagcttctacaaagtcaaagtt
ccagagctgaaggagatcatagggggctgcattcgcatgaacagtgatgaaaggtacacc
atccaggacctcctggatcaccccttcttccaggaaaacaacggcgtgcacgtggagctg
gcaaaggaggacgatatggtgaagtccggcctgaagctgtggctgcgcatggacgacacg
aagaagctccacggaaagtacaaggacaacaacgccatcgagttcctctttgagctctac
aaagacgtgcccgaggaggtggctcaggagatggtggtgcttgggttcgtgtgcgaagcc
gactttaaaatcgtggccaaggccatacgggacagggtgacggccatcaaacgccaacgg
gagaaactgaggaagcaggcggaggagcacaagaagaagcagcaacgggaagccatagaa
gaagaagcggaagctccgcctgtttcaccccaggtttccgaggcggtccctgcggagtcc
ccgcccccagccctcaccccgctggctcccatcctgtctccggtcaccagctccgtggac
tctggcgtcagctccagctaccccgcagagccggaggagcctgaagccgaccagcacttc
cacatgcgccacaacagcctgtcgtccgccaactctgactgcgagacagacggctatctg
agctcctctggtcttcaggacccgctggaggccggcggcttcaacacgcaggccacaccc
ccggccacatgcaaggaaggcccaccaactgcaaacggttttcccgtcccggctctccgc
ttcccctccgtgagtgaccttgacggtggaattgccacgtgtccttgcagttatgcctcc
gatgtagcctcgggcttgagtgatggctacgagggtctttcagagaagaacgagaaaacg
gccgccaggcgcactgctgggaaggtgttcagaaggagggcgcgatccaggctgcgcatc
acagggctctctgataaagtggaccgggtggtggagtgtcagctacagactcacaatgac
aagatggtgacgttcaagttcgacctggacggagacaatcccgaagacattgctgctgtc
atgatgaatttacagacctttgtcagtctttgtctgatagattctcgaactcgctgtgac
gcagatacaaaactcaaaatgttcctgtttgagaagattcagacttgtcactttgccttc
aaggtgcacaatgagttcatcctgccatcggagaaggagggcttcatctaccgtatgggg
gacattatcaagcgtgcggagtctctgatggccaaaggacagccgggccactccagcggg
caccgcatggcaccgcctgctttccacagtggggctaactcactgtcctcctcacaggtt
gctgcactggctgtgttaaggctgcttgtgagctctgtgaaaaaagctcatgtttcctgt
acatgtgttcttccagcctatctctacagtcacacccatcctcgcaccagcttttcctcg
tccctgcctggctcgccgctccatcaccaccaccactactatcctgcgtcccttctgccg
cagcaccagcactaccactcaccctacagtcacttccccttcccctacccggggtctcca
gagtcccccaagccagcccaccaccccacgctcacgcgtgtagccagtaaccccaccttc
ccctccgttcactcccctgtccccggttcccagagtcctcttcacgaggccccgcgtcca
ggcagcagcgacagcatcaccctgaccccacctggaactcagccccccaacatgtggccc
ccccacacgcagccccttttctccctagccaatgtgatctccatggccatgagcatggcc
cagtcgttcatacctcccacaggcctgaccacccagggcatgatctcatacccgggcttt
cacccccagatgcctgctcccattcctccacagactggttacccctccgtctaccccccc
cactaccacagcccaccgggagagttctcgtaccccgcagtaggcatcccagcaccgaac
aatatctaccaccggcccaagcctccgatggaaaatctggctccgcccggtaacctcacc
tggcagcctcccgtctcacccccctcaatggcttccacccctcctctggctccccaggag
cagcaggcgggaccctccagtccccccggacacatccagggggaccagggacaggcacca
ccacatacagcgcaggtccaaacccagactgagctcaggtcaaggaagagaaatcgcagg
agggcgtacagcctgagtctgctggggacgtcggcggacagcgggctctccgtgacggcc
gctgagctggagggcagactgtgggacggggcggcgggcagcccccagtacagcaacgcc
ctgcaccatctgtggatgatgacctacagccgcagcactccctacctgagcagcgatgac
tcggacagcgacgaagaggaaatcctggaggagcttcaagggctcagagagaaacacctg
acggaggttcagaccctgcaggccgcccagaaaaaggagatcgaggacttgtactag

DBGET integrated database retrieval system