KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00027237G001Help
Entry
GSTEN00027237G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K02365  separase [EC:3.4.22.49]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04110  Cell cycle
tng04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    GSTEN00027237G001
   04114 Oocyte meiosis
    GSTEN00027237G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tng01002]
    GSTEN00027237G001
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tng03036]
    GSTEN00027237G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.49  separase
     GSTEN00027237G001
Peptidases [BR:tng01002]
 Cysteine Peptidases
  Family C50: separase family
   GSTEN00027237G001
Chromosome and associated proteins [BR:tng03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   Separase
    GSTEN00027237G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C50 CHAT TPR_12
Motif
Other DBs
NCBI-ProteinID: CAG06749
UniProt: Q4RXY3
Position
11
AA seq 1659 aa AA seqDB search
LSRPFMLAVQASRRVGQLERALDWVVLWLKALGENITAHMAQPVSLWVKTKIDAARSSEE
DIRLRTLRDGFGPDVPDEETMLGLLGEELRAYKEVVGDTAQERYNTLCDLLEICHEESSH
THLRAVYLSEMAQVVCYQDFSQQTDCTALDFTLEALRLLEEEPETSGNADRLKDDRAQAL
LWHFICNLEKKLQDAIERDKLRELHGQNQSNANPTGTNDFDYEDKLKTEESTMVYEGLYF
NLDAENSFNNPLERALDEWSALLKSRDRPDVRNPKQTCLSLAVMAALFRLMGKLLKALEA
YQLLAGLSRQLADVQRCASALCQTSSILLEMGSPELALVIHKPFTKKLLSSELLSNMSYF
VLFVVFFPSFSNHKFILPKHQVDRGVPVLCAVLKEANEQRQSKSWYLLRALTLQTCSSYL
SLDTAALPQTQRRSITQHGLNSPDAALHEGLKLLCSLLVTLVGKGLYGSNGGSSEMRVIG
HGDNLVLKWQLLAELLSCSMKIAALRSRCGAVNDARLQCLEALKLAIKLQAPSQCAELLV
MKAELELMQGERDESVVDLEKVRNLLEICTDFSDKVKKAEVKIKPRKGRPAQKPQSPVPN
LDDDCKGILSTRWLLKEPLVKDPAASPPLKTLPRRWLSSLAHNSDCPCPCCSEPCLGRAT
ARWAATQADLIQLDPNDAEASLKLRSATLARCKSVSTKLAAKLAKLFSASLTNKSVAKLT
LMDDVVSRVYLSMVLSGLQPRQKEVCGVWSLLETGLAFIDATPSPALRPVKAGLMATKAM
LSLISMAVKQGCSPEELFSKAWNWNPPKAEELMSEEPKNAPPALPKKPREASRNPEKLKE
AKKTKVVKPKIDVPSSAAKTKRLVAMTPVAAKSKPDFFDFNTVVPTVTCTPVQRAKGPTL
VQKAPRTASKLQFHVYEEVSPTQDKARPVPAAPRRTKKSRFKVDFSDESDTDENTQTEPK
QKARAPQKRSTQRAVQNSRRTQDPPAERVLPQRQTRGSSRLPGSLHKKRTSPEDPSRTEG
DSVEEPDKMRTIDEEITEALDISIEQLRTSDAEDNPVSADNIDIDLEVLRRDICCDLDRD
DLPELRSREHPRKGPQTRLSHPDSRPDHLTLEDVQSLLRSAWLALAHFPSPPIYTTLSAL
LALSTGQQDPVTTAMLHAHSVGVTSRHRTIRHLSSFLKKLRKESTELADKMESLTLEEKS
PKGTKNSTEQMLLQLEDVFSFPTADPSTFPESHRREFTRLTQHIPQGVTVCVMSVLGVRP
GQMGESIMLSRFERGSAPVTVHIPTSKQQRPVSWMVQEMDEILVKQKVVSCVSEKAKWWE
GRRALDSRVEGLLKEMEELLGCWRSLLLPLSSDAELSKQARHLCSSLSAKGVKVDEDVLK
PVLSASSLLSQEDLRRFALGVSPQWDTQCDHLLHTAVAQLADREEPRGHVVLILDKYLQK
LPWESTSILKSHSVSRMPSLHSLVGLCVQREAEPESVLRKGVDSKQVFYVLDPDANLGNS
QDRFKEWFSSKLDWEGVCGVAPDLGQLEEAVATKDLYIYVGHGAGARFLDSQAVLKRRMR
AASLLFGCSSATLAVRGDQEGQGIILSYLMAGCPFVLGNLWDVTDRDIDRFTKALLEAWF
SAGSGAPLLSYMGSSRQATHLKHLIGAAPVVYGLPVHLQ
NT seq 4977 nt NT seq  +upstreamnt  +downstreamnt
ttgagccgtcccttcatgctggccgtgcaggcatctcggcgagtaggtcagctggagcga
gcgctggactgggtggttctttggctgaaagctctgggggagaatatcaccgctcacatg
gctcaaccggtctccttgtgggtgaagacaaaaattgacgcagctcgcagctctgaggag
gatattcgtctcaggaccctgcgtgatggctttggcccggacgtcccagatgaggaaaca
atgcttggcctgttgggggaggagctacgcgcctacaaggaggttgttggtgacacagcc
caagagcggtacaatactctgtgtgatctgctagagatctgccatgaggagagctcccac
acccacctgagagctgtttacctctccgagatggcccaagtggtgtgttaccaagacttt
agtcagcaaactgactgcacagcgctggactttacccttgaagctctgcggctactggaa
gaagaacccgagacttcagggaatgctgacaggctgaaggatgacagggcccaggcttta
ctgtggcatttcatctgcaacctggaaaagaagcttcaggatgccattgaaagggacaaa
ctgagagagctgcatgggcagaatcaaagcaatgccaatcccactggaaccaatgatttt
gattatgaagacaagctgaagacagaagagagcacgatggtctacgagggcctttatttc
aacctggatgcagagaacagttttaacaaccctttggaacgcgccctggatgagtggtca
gccctcctgaagagtcgggaccggcctgatgtgaggaaccccaagcagacctgtctgtct
ctcgctgtgatggctgctctcttcaggctcatgggaaagctcctgaaagccttggaagcc
taccagctactggctggactctcacgccagttggcggatgtccagagatgtgccagtgcc
ctctgtcagacctccagtatcctactggagatgggatcccctgagctcgcactggtaata
cataaaccatttacaaaaaagctgctgtcgtccgaacttctttcaaatatgagttatttt
gtcttatttgttgtttttttcccctctttctctaatcacaagttcattttgcccaaacat
caggtggaccgcggggtgcctgttctgtgtgcggtgcttaaagaagcgaatgaacagaga
cagtcaaaaagctggtacctgctgcgcgctctgacgctccagacctgcagctcctatctg
agtttggacacagctgcattaccacaaacgcagcggcgctccatcactcagcatggtctg
aacagtccagacgctgccctgcatgaaggtctgaagctcctctgcagcctgctggtcact
ttagttgggaaaggcctctatggatccaatggtggcagctcagagatgcgcgtcattggc
cacggagataacctggtgctgaagtggcagctgcttgcagaattgttgagctgctctatg
aagatagctgctctgaggagccgctgcggggccgtcaacgatgctcgactccagtgtctt
gaagccctcaagctggccatcaagcttcaagccccgagccaatgtgcagaactgctggtg
atgaaagctgagttggagctgatgcagggggagagagatgaaagcgtagtagatctggag
aaagtaagaaaccttttggagatttgcacagatttctctgataaggtgaaaaaggcagag
gttaaaatcaaacctcggaaaggtcggccagcacagaaaccccagtcccccgttcctaac
ttggatgacgattgtaaaggaatcctaagtacgaggtggctcctcaaagaaccgctcgtg
aaggatccagccgcctccccgccccttaaaactctgcctcgccgctggctttcatccctg
gcgcacaactccgactgcccgtgcccctgctgctctgagccctgcctgggccgcgccacc
gctcgctgggcagccacacaggcagatctgattcagctggatcccaatgacgccgaagcc
agtctgaaactccggtcggcaacgcttgctcgctgtaagagcgtgtcgacaaagctcgcg
gcaaaattggctaaactgttctctgcaagcttaacaaacaaaagtgtagctaaactcacc
ctgatggacgatgtggtgagccgtgtgtacctgtctatggttctttctgggctacaaccg
agacagaaggaggtgtgcggtgtgtggagtttactggagactggcttagcctttattgat
gccacgccctctcctgccctaagacccgtgaaagcaggcctgatggctaccaaagcaatg
ctgtcattgatcagcatggctgtgaaacagggctgcagcccagaagaactcttctcaaaa
gcttggaattggaatccgcccaaagcagaagagctgatgtctgaagaaccaaagaatgct
cctccagcattacccaagaaacccagagaggccagtagaaatcctgagaaattaaaggag
gcaaagaaaaccaaagttgtcaagcccaagattgatgtgcccagctctgcagctaaaacc
aagcggctggtcgccatgacaccggtggcagcgaagtcaaaacctgacttttttgacttc
aacaccgtggttccgacagtgacctgtactccagttcaaagggcgaaaggcccaactttg
gtacagaaagcaccaaggaccgcatccaagttgcagtttcacgtgtatgaagaggtgtca
ccaactcaggataaagcgagaccagtgcctgctgctcccagacgcaccaagaaatcccgt
ttcaaggtggactttagtgatgagagcgacactgacgaaaatacacagacagaacccaaa
caaaaagcacgggctcctcagaagaggtctacacaaagagctgtccagaactccagaagg
acccaggatccacctgcagagcgagttttgccacaaagacagacaagaggcagctcccgt
ctgccgggcagcctccacaagaaaaggacgagcccggaggacccgagcaggacagaagga
gattcagtggaagagccagacaaaatgaggaccattgatgaggaaatcacagaggctctg
gacatcagcattgaacagctgaggacgtcagacgccgaagacaaccccgtctcagctgat
aatattgacatcgatcttgaggtcttgcggagggacatatgttgcgacttggatagggat
gacttacctgaactgaggagcagagagcacccgagaaaaggtccacaaacacgcctgtct
catccagacagcagaccagaccatctaactctggaagatgtccagtcgctgctgcgctcc
gcctggttggcgctggcacatttcccatctccccccatctacaccaccctttcggccctt
ctggccttatcaacgggccagcaggaccccgtaactacagccatgctccacgcccattct
gtgggggtcacaagtcgccatcgcaccatccgacatttatccagttttctgaagaagctg
agaaaggaatccaccgaactcgcagacaagatggagtctctgactctggaagaaaaaagt
ccaaaaggcactaagaactcgacagagcagatgttgttgcagctggaggacgtcttctct
ttcccaaccgctgacccgtccaccttccccgagagccaccgtcgagagtttacacggctg
actcagcacattcctcaaggcgtgaccgtgtgtgtgatgtctgtactcggagtcagacct
ggacagatgggcgagagcatcatgctgtcacgatttgagaggggatctgccccggtcacc
gttcacatccccacctccaaacagcagcgacccgtcagttggatggtgcaagagatggac
gaaatcctggtcaaacagaaggttgtgagctgtgtgtctgagaaggccaaatggtgggag
ggtcgcagggcgctggactctcgggttgagggactgttaaaggagatggaggaattgttg
ggatgctggaggagcttgcttctaccgctttcctcagatgctgagctgtccaaacaagct
cggcacctctgcagttccttatcggcaaagggagtgaaggtcgatgaagatgtgttgaag
cctgtgctgtcggcatcgtctctgctctctcaagaagatctcagaagatttgccctggga
gtttctccacagtgggacactcagtgtgaccatcttctacacacagctgtggcccagctc
gcagacagagaggagccccgcggccacgttgttctcatcctggacaagtaccttcagaag
ctgccatgggagagcacgtccatcctgaagtctcactccgtcagccggatgccttctctg
cactcactcgtgggtctgtgcgttcaaagagaggccgaaccggagtccgtcctgaggaag
ggagtggattcaaaacaggtgttttatgtgctcgaccctgacgccaacttgggaaactct
caggatcgctttaaggaatggttcagcagtaaactggattgggagggagtgtgtggagtc
gctcctgacctgggtcagctggaagaagctgttgccactaaagatttatacatttacgta
ggacacggggcaggtgcgcggttcctggacagccaggcggtgctgaaacggcggatgaga
gccgcctccctgctgtttggctgcagcagcgccacactggcagtgcgcggtgatcaggaa
ggtcagggtatcattctcagctacctcatggcaggatgtccgtttgtgctgggaaacttg
tgggacgtgacggacagagatatcgaccggttcactaaagccctgctggaagcctggttt
tctgctgggtctggagctcctcttctgtcctatatggggtcctcccgccaggccacacac
ctgaagcacctcatcggagctgcacctgtggtgtacgggttaccagtccacctgcag

DBGET integrated database retrieval system