KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00029123G001
Entry
GSTEN00029123G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K09093  aryl hydrocarbon receptor
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tng03000]
    GSTEN00029123G001
Transcription factors [BR:tng03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    GSTEN00029123G001
SSDB
Motif
Pfam: PAS_3 PAS PAS_9 PAS_11 HLH
Other DBs
NCBI-ProteinID: CAG08210
UniProt: Q4RTS2
Position
2
AA seq 862 aa
LHRRKPSDGNVVTKSNPSKRHRDRLNGELERLTDLLPFSEEVRSRLDKLSVLRLSVGYLR
VKNYCSASTRCSKTGVGSPGVSGHNGSSADAAGFPEGDLLLQALNGFVMVVTSEGLVFYV
SPTVKDYLGFHQSDVVHQSVFELIHTDDRGTFRQQLHFALNPPAENDGEGSEFPGQTEVP
PWSEGVAGQWDLQPPSAGPLHHRCARPPSAHPGNQGQNAALSKQAQVGLHAHGHRQQGEG
YSGLFGDGALYERLRLPVHPRSRYDVLRRQPPPQYVASWRPQLNSPLIHLCRANAHVSLV
CLFPPVIKTGESGMTVFRLLSKSSGWVWVKANAKLIYKGGRPDFINVYQRALVNAEGEEY
LRQRRRQLPFSFTTGEAVLYDTGPTVDISQFQFNKMFADGDLARKVAPGSLLDSFLKQDE
TAYTSASSSPLPVDQVFVNSRALLSIASDAWSEHGDMSVTGVMKEEAKQSMMSVIHNLEN
GDLCSVLQNLDVDDSELMQWENALSRLSQSENHCVASQLESLFTSDIFDCIDSILFKGNG
ENLNGAHPSLFDPQQEPAAGLCEPPWFPTPSPECTYPPCAPTQTFSNTRKLSHLAPGREA
APPQLAGPQASATFQSCRQVHVGHPPEPSQQPRQMFVGAHTAPQPDGELQQSAVEPQLAD
LFSPLVSCADFWSPACNVPVCFSSECVKNSPPLQTCNRQVQEWQQRQLQVPPAGVKQNGH
EQRPARHSLTSGGSGLWQNNGPRLTPGQQGGLARSRAAAQSSCMFAQRFSGVAALSGPSG
PRWAEVHMDQSPPQGSCYFQWGPSEPVVGSSAISQEDVSVSPLSRPATLPSAEHAFNIQP
YLCVSATDRYSAPTVGCRTVTK
NT seq 2589 nt   +upstreamnt  +downstreamnt
cttcataggaggaaaccgtcggatggcaatgtggtcactaaatccaacccgtcgaagcgc
caccgggatcgtctgaatggagagttggagcggctgacggacctcctgcctttctccgag
gaggttcgctctcgcctggacaaactgtccgtcctccgcctgagcgtgggatacctgagg
gtcaagaactactgcagcgcgtccaccaggtgcagcaaaaccggtgtggggagtcctgga
gtgagtggacacaatggcagcagcgcggacgccgccggcttccccgagggggacctgctg
ctgcaggcgctgaacggcttcgtgatggtggtcacatcagaagggctggtcttctacgtc
tctccaacagtcaaggactacttgggttttcaccagtcggacgtggttcaccagagcgtg
tttgagctcatccacaccgatgacagaggcaccttcaggcagcagctgcactttgctctg
aaccccccagctgagaacgacggagagggctctgagtttccagggcagactgaagtacct
ccatggtcagagggcgttgcgggacaatgggacctgcagccaccctcagctggccctctt
caccatcgctgtgcccgtccaccctccgcccatcctggaaatcagggccaaaatgctgct
ctttcaaagcaagcacaagttggacttcacgcccatgggcatagacagcagggggaaggc
tattctgggttattcggagacggagctttgtatgaaaggctccggctaccagttcatcca
cgcagccgatatgatgtactgcgccgacaaccacctccgcagtacgttgccagctggcgc
ccccaactgaactcacctttgatacatttatgccgcgctaatgctcatgtttcgcttgtc
tgtctttttccgccagtgattaaaaccggagagagcggtatgactgttttccggctcctg
agtaagtccagtgggtgggtgtgggtgaaggccaacgccaagctgatctacaaaggagga
agacccgatttcatcaatgtctatcagagagcgctagtcaacgctgagggcgaggaatac
ctgcgccagaggagacgccagcttcccttcagcttcaccacgggggaggccgttctttac
gacacaggacccacggtggacatctcgcagttccagtttaacaagatgttcgccgacggt
gatttggccaggaaagtggcccccggctctctgctggacagcttcctcaaacaggacgag
acagcctacaccagcgcgtccagcagccccttacctgtagatcaggtgttcgtcaacagc
cgggccctgctcagcattgccagcgacgcctggtcggaacatggcgacatgtcggtgaca
ggcgtgatgaaagaggaggccaagcagtcgatgatgagcgtgatccacaacctggaaaac
ggggacctctgttccgtactgcagaacctggacgtggatgactcggagctgatgcagtgg
gaaaatgccctcagcagattgagccagagcgagaatcactgtgtcgcctcccagctggag
agcctcttcactagcgacattttcgactgcatcgacagcattttgttcaaagggaacgga
gaaaatctcaacggagcccatcccagcctcttcgacccccagcaggagcctgctgctgga
ctctgtgagcctccctggtttcccacacccagcccagagtgtacctaccccccgtgtgcc
cccactcagaccttcagcaacactaggaaactctcccacctggccccaggtagggaggct
gcccccccacagctcgctggcccccaggcctcagccacttttcagtcctgcaggcaggtg
cacgtgggccaccctccggaaccgtcccagcagcccagacagatgttcgtgggcgcacac
acagcaccgcagcctgacggagagttgcagcagagcgccgttgaaccgcaactcgccgac
cttttctcacctctggtttcctgcgccgatttttggtcacctgcttgtaacgttccggtc
tgcttttcctcagagtgcgtgaagaacagcccccctctgcaaacatgcaaccggcaggtt
caggagtggcagcagcggcagctccaggtgcctccggctggcgtcaagcagaacgggcac
gagcagaggccagctcgccacagcctgacgtcaggaggctccggcctgtggcagaacaat
ggccccagactgaccccaggtcagcagggagggctggcacgcagccgtgcagcagctcag
agcagctgcatgttcgcccagcgtttctccggcgtggccgctctgtccggaccctccggc
ccccgatgggctgaggtgcacatggatcagagtcctcctcagggctcctgctatttccag
tggggccccagcgaacccgtggtgggctcgtcagccatcagccaggaggacgtcagcgtc
agccccctcagccgcccggccacactgccctcggccgaacacgccttcaacatccagcct
tacctgtgtgtgagtgccacagacagatactcggctcccactgtggggtgcagaacggtt
acaaaatga

DBGET integrated database retrieval system