KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00029280G001Help
Entry
GSTEN00029280G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00450  Selenocompound metabolism
tng00970  Aminoacyl-tRNA biosynthesis
tng01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    GSTEN00029280G001
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    GSTEN00029280G001
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tng01007]
    GSTEN00029280G001
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tng03016]
    GSTEN00029280G001
Enzymes [BR:tng01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     GSTEN00029280G001
Amino acid related enzymes [BR:tng01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   GSTEN00029280G001
Transfer RNA biogenesis [BR:tng03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    GSTEN00029280G001
 Prokaryotic type
   Other AARSs
    GSTEN00029280G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: CAG08330
UniProt: Q4RTF2
Position
1
AA seq 492 aa AA seqDB search
MASFRYASTENRNYYITTPIFYVNASPHLGHLYSVVIADCFHRQKQLQGFNSRFTTGTDE
HGLKIQQAAEAAGRDPLTFCTSVSERFRNLFSSCNISNTDYIRTTEPRHHRAVRHFWSVL
YGKGLIYKGRYEGWYSTQDESFLMPSQVTTAQDSEGKEIKISLESGHKVEWMKEENYMFR
LSRFRLQLLDWLRENPRAIQPERFYHSVLQLLQEELPDLSVSRQKSRLQWGIPVPDDPEQ
TIYVWLDALVNYLTVVDYPHNHERWWNVAHHVIGKDILKFHAIYWPAFLLGAGLPLPQTI
HVHSHWTVAGKKMSKSLGNVVDPRERSQAFTNDGLRYFLLRQGVPDADCDYRDDKVRKLL
NSELADALGGLLNRCTAPALNPAQVYAPFCPDAFPGQRGGRAVDEDYRMLDSVKHLPAVV
EQHFENMHVYKALEAIGACVRQTNGFVQRHAPWKLDRGDAGDQRWLSTVIHVSPRMLEDL
WHPPPASSAGNI
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggctagcttcagatacgcaagcacagaaaacaggaattactacattaccactccgatc
ttttacgtcaacgcttctcctcatttaggacacttgtattcagttgttattgctgactgc
tttcacaggcaaaagcaactccagggctttaactccaggtttaccacaggcacagacgag
catggtttgaaaattcagcaagcggctgaagctgcaggaagagatccgctgaccttctgc
acctctgtgtcggagagattcaggaatctcttcagcagctgcaacatatccaacacggac
tacatccggaccaccgagccgagacaccatcgggccgtgcggcacttctggtcggtgctc
tacggcaaagggctcatctacaaagggcgctacgaaggctggtattccactcaggatgaa
agcttcctcatgccatcgcaggtcaccactgcccaggactccgaggggaaagagatcaaa
atatcgctggagagtggtcacaaggtggagtggatgaaagaggagaactacatgttccgt
ctgtctcggtttcgccttcagctgctggactggctcagagagaatcctcgggccatccag
cccgagcgcttctaccactctgtcctccagctgctgcaggaggagcttcccgatctctcc
gtgtcccgccagaaaagtcgcctccagtggggaatcccggtcccggatgatcccgaacag
accatctacgtgtggttggatgcgctggtgaactacctgacggtcgttgactatccgcat
aaccacgagagatggtggaacgtggcgcaccacgtcatcgggaaggacatcttaaaattt
cacgccatctactggccggccttccttctgggcgccgggctgcctctgcctcagaccata
cacgtgcactctcactggacggtggcagggaagaagatgtccaagagtttggggaacgtg
gtggatccccgcgaacgctcgcaggcgttcacaaatgacggcctgaggtactttctcctc
cgtcagggggtcccagacgcggactgcgattacagagacgacaaagttagaaagctgctc
aactcggagctggcagacgctctgggaggcctgctcaaccgctgcacggctccggcactt
aaccccgctcaggtctacgcgcccttctgcccggatgccttccccggccagcgtggaggt
cgagccgttgatgaagactaccgcatgctggacagcgtgaaacacctccctgctgtggtg
gagcaacactttgagaacatgcacgtttataaggcgctggaggcgatcggcgcctgcgtg
aggcagaccaatggctttgtccagcgccatgcgccgtggaagctggacagaggggacgcc
ggagaccagcgctggctcagcaccgtgatccacgtttcccctcgaatgcttgaggattta
tggcaccctcctccagccagtagtgccggaaatatctaa

DBGET integrated database retrieval system