KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00029325G001
Entry
GSTEN00029325G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K05225  apelin
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04080  Neuroactive ligand-receptor interaction
tng04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    GSTEN00029325G001
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    GSTEN00029325G001
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-ProteinID: CAG08364
UniProt: Q4RTB8
Position
1
AA seq 63 aa
LIVLSCCPGPMASTEHGKELEETATVRKMVQQNPARGGQTHRPAGWKRRRPRPRLSHKGP
MPF
NT seq 189 nt   +upstreamnt  +downstreamnt
ctaattgttctctcatgttgtccaggtcccatggcctccacggagcatggcaaggagctg
gaagagacagccacggtgaggaaaatggtccagcaaaaccctgcaaggggcggtcagacc
cacagaccagccggctggaagaggagacgcccacggccacgtctttcccacaaggggccc
atgccattc

DBGET integrated database retrieval system