KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00029623G001Help
Entry
GSTEN00029623G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng00480  Glutathione metabolism
tng00590  Arachidonic acid metabolism
tng01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tng00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    GSTEN00029623G001
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GSTEN00029623G001
Enzymes [BR:tng01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GSTEN00029623G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: CAG08606
UniProt: Q4RSM6
Position
12
AA seq 210 aa AA seqDB search
MEALGGYPTRSSNPKAKKLTVLLSMTVGVGCLLLLQTQLLKPRRPSDFYSFEVKDAKGRT
VSLEKYRGKASLVVNVASRSEQTESNYRSLQELHRELGPSHFNVLAFPCAQFGETETGSS
RDSEAFAKATYGVTFPFFSRIKIMGSEAEPAFRFLTDSVQKVPRWNFWKFLVNPEGKVVR
FWRTDEPMESIRREVTALVREIILKKRVEL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggaggccttagggggctaccctacgaggtcctccaaccccaaagccaagaaactgacc
gtcctgttgagtatgacggtcggggtcgggtgcctgctcctccttcagacgcagctgctg
aagccgaggcgaccgtcggacttttattccttcgaggtgaaggacgcaaaaggcaggacg
gtttctctggagaagtaccgtggaaaagcgtctttggttgtaaacgtggcgagtcgcagc
gagcagacggagagcaactaccgctctctgcaggagctgcaccgggagctgggcccctcg
cacttcaacgtgctggccttcccctgcgcccagttcggggagacggagaccgggagcagc
cgggacagcgaggccttcgccaaggccacctacggcgtcaccttccccttcttcagcagg
atcaaaatcatgggctccgaggctgagcctgccttcaggttcctcacagattctgtgcag
aaagtccccaggtggaacttctggaagttcctggtgaacccggagggtaaggtggtccgc
ttctggcggacggacgagcccatggagagcatccgacgagaggtgacggcgctggtgcga
gaaatcatccttaagaaacgggtggagctatga

DBGET integrated database retrieval system