KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00029641G001
Entry
GSTEN00029641G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tng01002]
    GSTEN00029641G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     GSTEN00029641G001
Peptidases and inhibitors [BR:tng01002]
 Metallo peptidases
  Family M1
   GSTEN00029641G001
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-ProteinID: CAG08622
UniProt: Q4RSL0
Position
12
AA seq 942 aa
LLLLLLLLLSASPPGAQMSNPGQEEGPTSTSGQPFPWHHMRLPKTVSPLHYDLAIHPNLT
TLDFSGVVRIQLEVHRDTSLVILHAKQMQISEALLLAPEGARPLRVLEYPRFHQLALLLD
SPLAKGGTYQVLLGFSANLSDSFHGFYKSSYRTSSGEVRVLASTQFEATFARAAFPCFDE
PAFKAKFTIQIIREPRHIAISNMPIERRRLLHVKTVELPGGLLEDHFDTTVKMSTYLVAY
IVSDFLSVSKTTHRGVKISVYAVPEKIDQTALALDAAVTLLDFYEEYFHIPYPLPKQDLA
AIPDFQSGAMENWGLSTYRETALLYDPHKSSPSDKLAVTKWFGNLVTMEWWNDLWLNEGF
AKFMELISVNVTHPELQVDDVFLGKCFEAMEVDSLPSSHPVSTHVENPVQIQEMFDDVSY
DKGACILNMLRDFLTPEAFEIGIIRYLKHFSYQNTVSQHLWESLSNVSAWWFSDDELDVQ
AIMDTWTLQEGFPLVTVEVRGREVRLSQERYLKTDDPSLTEGFLWQIPLTYVTSASSTVH
RFLLKTKTDVLYLPQEVDWLKFNVDMSGYYMVHYAGDGWNAIIHLLQHNHTVLTSNDRAS
LIHDVFQLVGVGKVRLDTALDLSLYLSRETETMAVTQGFEELVPLYKLMEKRDMAALENQ
MKGYIVDLFRGLIDRQNWDDSGSVSERVLRSYLLLFGCVRNYPPCVEKATRLFNEWRASG
GHMSLPVDVTMAVFMMGARTPEGWDFLFEKYRTSLQMSVKSRMKVAMAFSPLRDKLAWML
EQSVQGDVMKLQDLPDVVVTVSRNPRGYNLAWDFLRANWHTLIKKFDLGSNIIAYMVTGV
TNRYSTTEMLDEHLPGHPGCGPLHPVLHQLLQGVPALQRGSDREGGMATLRPGRSASHIL
HPLLWKPITSRRRGSQQGASVQPGLPAATVQRCQLRAPTFLQ
NT seq 2829 nt   +upstreamnt  +downstreamnt
ctgctgctgctgctgctgctccttctctccgcgtctccaccaggagctcagatgtccaac
ccaggacaggaggaagggcccacgtccaccagcggccagccgttcccctggcaccacatg
aggcttcccaaaacggtgtcccccctccactatgacctggccatacaccccaacctgacc
acccttgacttcagcggagtggtccggatccagctggaggtgcaccgagacaccagcctc
gtcattctccacgccaagcagatgcagatctccgaggcgctgctcctggctcctgagggc
gcgcggccgctccgggttctggagtatcctcgcttccaccagctggccctgctgttagac
agccccctggccaaaggtgggacgtaccaggttctgctggggttttccgccaacttgtcc
gacagcttccatggtttctacaaaagcagctaccgcaccagcagcggggaggtcagggtg
ctggcctcgacccagtttgaagccacctttgctcgtgcggccttcccctgttttgatgag
ccagcttttaaagcaaaattcaccatacagatcatccgggagccgcgccacatcgccatc
tccaacatgcccattgaacgcagacgcttgcttcacgtcaagacggtggagttgccgggc
ggcttgctggaggatcacttcgacaccacggtgaaaatgagcacgtacttggttgcctac
atcgtctctgacttcctatctgtgagcaagaccacacaccgcggcgtcaagatttcagtc
tacgctgtgccggagaagatcgaccagacggcccttgccctggacgctgccgtcacgctg
ctggacttctacgaagaatactttcacattccttatcctcttcccaaacaggatctcgct
gctatcccagacttccagtcgggagcgatggaaaactggggcttgtccacgtatcgagag
acggccctcctctatgatccccacaaatcatccccctcagacaaactggctgtcaccaag
tggtttggaaacctggtgacgatggagtggtggaacgacctgtggctcaacgagggcttt
gccaaattcatggagttaatttctgtcaatgtcacccacccagagctgcaagtggatgac
gtcttcttggggaaatgctttgaggccatggaggtggactccctcccctcctcccacccc
gtctccactcacgtggagaatccggtgcagatccaggagatgtttgacgatgtctcgtac
gacaagggagcgtgcattctgaatatgctgcgggacttcctgactcctgaggcctttgaa
atcggcatcatccgatacctcaaacacttcagctaccagaacaccgtcagccagcacctg
tgggagagcctgtccaatgtgagcgcgtggtggttctctgatgacgagctggacgtccag
gccatcatggacacgtggacgctgcaggaaggcttccccttggtcaccgtagaggtcaga
ggtcgcgaggtcaggctgagtcaggagcgttacctgaagaccgacgacccctccctcact
gaggggttcctgtggcagatcccgctgacctacgtgaccagcgcctccagcaccgtccac
cgctttctgctgaagacaaagaccgatgtgctttacctccctcaggaggtggactggctg
aagttcaacgtggacatgagcggctactacatggtccactacgcgggcgatggctggaac
gccatcatccatctgctgcagcacaaccacaccgtgctgaccagcaacgaccgggccagc
ctcatccacgacgtcttccagctggtcggcgtggggaaggtgaggctggacacggctctg
gacctgtccctgtacctgtccagagagacggagaccatggctgtgacccagggcttcgaa
gagctggtgcctctgtacaaactgatggagaaaagagacatggccgctctggagaaccaa
atgaagggctacatcgtggatttgttccggggcctgatcgatcgccagaattgggatgac
tccgggtccgtgtctgaacgggttctgaggagctacctgctgctgttcggctgcgtcagg
aactaccctccctgtgtggaaaaagccacccggctcttcaacgagtggagggcctccggg
ggccacatgagcctgccggtcgacgtcaccatggccgtctttatgatgggggctcggaca
ccggagggctgggacttcctctttgagaaataccgcacgtcgctgcagatgtctgtaaaa
agccgaatgaaggtggcgatggcgttcagccctctgcgggacaagctcgcctggatgctg
gagcagagcgtccagggcgacgtgatgaagcttcaggacctgccggacgtggtcgtcact
gtcagcaggaaccctcgcggctacaatctggcctgggacttcctgcgggccaactggcac
accctgatcaagaagtttgatttgggctccaacatcatagcctacatggtgactggagtt
accaaccggtattccaccacagagatgttagacgagcatcttcctgggcatcctgggtgt
gggcctctccatcctgttctgcaccagcttctgcagggcgtgccagcgttacagagaggc
tcagatcgagagggaggcatggcgacgctccgtccaggacggtcagcctcccatatactt
catccccttctctggaaaccgatcacatctagacgcagaggatcccagcagggagcctcg
gtacagccaggactaccagccgccacagtacagcgctgtcagctacgggcccccaccttc
ctacaatga

DBGET integrated database retrieval system