KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00031632G001Help
Entry
GSTEN00031632G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K05197  glutamate receptor 1
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    GSTEN00031632G001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tng04040]
    GSTEN00031632G001
Ion channels [BR:tng04040]
 Ligand-gated channels
  Glutamate (ionotropic)
   GSTEN00031632G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3
Motif
Other DBs
NCBI-ProteinID: CAG10116
UniProt: Q4RNB6
Position
1
AA seq 879 aa AA seqDB search
CSQFSKGVYAIIGLYDRKTVNMLTSFCGALHVCFITPSFPIETANQFVIQLRPELQDALV
GVIEHYGWTKFVYMYSSDSGLSVLQKVLDTAAERNWLVTSVNVETMTEASFLKVFQDLDK
RKEGQIIIDCETERLTGILKKIVEQGKNAKSYHYILANLGFLDIDLTDLRKGGANITGFQ
LVNNSDPTVSRVVQQWVEFDNKDSKMAKSGLKYTGALTYDGVKVMSTAFQNLRRQRIDIS
RRGNAGECLANPPAPWGQGIDIQRALQQVRIDGLTGHIQFNEKGRRTNYTVSIMELAPSG
PKKVGYWNEEEKYVNTASFVRGSNDTYGLQNRTYIVTTILQCPIPLVKTAFFSPSSHYTV
PSGSHDLLSSEMLWRNCGAARSFLAPLVLRDPETKMWNGMVGELVYGKADVAVAPLTITL
VREEVIDFSKPFMSLGISIMIKKPTKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLV
SRFSPYEWHAEDYEEGGEPQSPTQAAASNGVQQSQTPVQQNANQQSPEQTNEFGIFNSLW
FSLGAFMQQGCDISPRHELYTKPWSRMGNLPDPRSLSGRIVGGVWWFFTLIIISSYTANL
AAFLTVERMVSPIESAEDLAKQTEIAYGTLDAGSTKEFFRRSKIAVFEKMWSYMKAADPS
VFVRTTDEGVMRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKKPSKPGSVKTERAGPLGQ
IEKQVVVRQGRVRAAGAGTPRIPVNLAVLKLNEQAVLDKLKNKWWYDKGECGNKDSGRKD
KTSALSLSNVAGVFYILIGGLGLAMLVALVEFCYKSRTESRRMKQSINDAMRCSTLTRMS
GNGSSGENGRILTHDFPKTVQTLPCMSHTASMGLGASGM
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
tgctcccagttctccaagggcgtgtacgccatcatcggcctgtatgacaggaagacagtc
aacatgctcacgtctttctgtggagcgctgcacgtctgcttcatcactccgtccttcccc
atcgaaacggcaaaccagttcgtcatccagctgcggcctgagctccaggatgcactggtg
ggggtgattgaacactatggatggaccaagtttgtctacatgtacagttctgactctgga
ctgtcagtactgcagaaggttctggacacagcagcagaaaggaactggctggtgacctcg
gtgaacgtggagacaatgacggaggcctccttcctgaaagtgttccaggatctggacaag
aggaaggagggacagattatcatcgactgtgagacggagaggctcactggcattttgaaa
aagatcgttgagcaaggcaagaatgcaaagagctaccactacatcctggctaacctgggt
ttcctggacattgacctgacagacctgaggaaaggtggcgctaacatcaccggcttccag
ctcgtcaacaactctgacccgactgtcagtcgtgtcgtccagcagtgggtggagttcgac
aacaaagactccaaaatggccaagagtgggctcaaatacacaggcgcgctgacatatgat
ggggtgaaggtcatgtccacagcctttcagaatttaaggagacagagaatagacatctct
cggaggggcaacgctggagaatgccttgccaaccctcccgctccctggggacagggcata
gacatccagagagccttgcagcaggttcgaattgatggattaaccggtcacattcagttc
aatgaaaaggggcgccgaaccaactacactgttagcatcatggaactggctccatctgga
ccaaaaaaggtcggctactggaatgaagaggagaaatacgtcaacactgccagtttcgtg
aggggcagcaatgacacttacggcctccagaacagaacttacattgtcacgaccatcctg
caatgccccatccctcttgttaaaactgcttttttttctccttcatctcactatacagtt
ccctctgggtcacatgacctgttaagttctgagatgctgtggaggaactgtggagcagca
aggagcttcttagctccattggttcttagagatcccgaaactaagatgtggaatggcatg
gtgggggagctggtttatgggaaagctgatgtggctgtggctcctctgaccatcactctg
gttcgtgaggaagtcattgatttctccaagcccttcatgtctttgggcatttccatcatg
attaaaaaacccaccaaatccaagcctggcgtcttttccttccttgaccctttggcctac
gagatctggatgtgcatcgtgttcgcctacattggcgtcagcgtcgtcctcttcctggtc
agtcgattcagcccctacgaatggcacgccgaggactacgaggaagggggagaacctcag
tctcccacgcaggctgcggcctccaacggggtgcagcagagccagacaccggtgcagcag
aacgccaaccagcagagtccagaacagaccaatgagtttgggatcttcaactcgctatgg
ttctcactgggggcctttatgcagcaaggatgtgacatttcaccacgccatgaattatac
accaaaccctggagccgcatgggaaatttacctgacccaagatctctctctggccggatt
gttggaggtgtctggtggttcttcaccctcatcatcatttcttcctacactgcaaacttg
gctgcctttctgactgtggagaggatggtgtctcctatagagagcgccgaggatttggcc
aaacagactgagattgcctatggaacactggatgctggctccacaaaagaatttttccgg
aggtccaagattgccgtgtttgaaaagatgtggtcctacatgaaggcggctgacccatcc
gtgtttgtcaggaccaccgatgagggcgtaatgagagtcaggaagtccaagggcaagtat
gcctacctcctggagtccaccatgaacgagtacatagagcagaggaaaccgtgtgacacc
atgaagaaacccagtaaacctggcagtgttaaaactgaacgagcagggcctcttggacaa
attgaaaaacaagtggtggtacgacaagggagagtgcgtgcagcgggggcggggactcca
agaatcccagtcaacctagcggtgttgaaactcaatgagcaagccgtcttagacaaactg
aaaaacaaatggtggtacgataaaggggagtgtggcaacaaggactctggaagaaaggac
aagaccagcgctctgagcctgagcaacgtggcgggggtcttctacatcctgattggcggc
ctgggcctggccatgctggtggcattggtggagttctgctacaagtccaggaccgagtcg
cgccgaatgaagcaatccatcaacgacgccatgcgctgctccaccctgacccggatgagt
ggcaatgggagcagcggagagaacggacgaatcctcacccacgatttccccaagaccgtt
cagacgctgccctgcatgagccacaccgccagcatgggactgggtgcttccggcatgtga

DBGET integrated database retrieval system