KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00031855G001
Entry
GSTEN00031855G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K09093  aryl hydrocarbon receptor
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tng03000]
    GSTEN00031855G001
Transcription factors [BR:tng03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    GSTEN00031855G001
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS PAS_9 PAS_4
Other DBs
NCBI-ProteinID: CAG10275
UniProt: Q4RMV7
Position
3
AA seq 640 aa
MGDRAGRSLIPNVAHPPQKTGGVIQALNGFVLVVTAEGYVFYTSPTIQEFLGFHQSDVIH
QSVFELIHTDDRALFRNQLHFAFNPTNSQQDSGCDSPGDQNSVEISTNMLTYDPQSIPPE
NSSFLERSFCCRFRCLLDNSSGFLALNFHGRLKFVHGQNQMSEDGALVHPQLALFAIATP
MQPPSIVEIRAKTLLFQTKHRLDFTPMGIDTRGKIVLGYNEIELCMKGSGYNFIHAADMM
YCADNHIRMIKTGESGFTVFRLLTKSGSWVWVQANARLVFKDGRPDFIVARQRALTNEEG
EEQLHLRRLQLPFNFTTGEAMLYDVAPTVGPPDSCSTPKQRKLDNGSVSPNSILGCMMNQ
DQSLYHNNNTVASVDDLAFRDTHATLSVPGDVWVDPTGSLMKSEAAVQDMMDTLQQILGE
NQLSDTLDVEPEELKSWESTLLKLSTSCDMGDDLCDLLSNDVLTFVEEQLQREGAFQTPH
QLEEVPPCLDLQGRQSFSWPGVPQEPGLSGTVKLTHIDLPQTSAGLDVPALQLLDFQQSS
GLPLESCTPAAPRAEEAGLRAFSANQNHCHQVPRPIRSHPASVREPDPVFAFQGSHWSST
PGQPDPFVGSYAGHVSSQRASGPTGRGPAAFRDTLPSRSR
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgggcgacagagccggtcgctcgctcatcccaaatgtggcacatccaccgcaaaagaca
ggtggcgtcatacaggccctgaacggtttcgtgctggtggtgacggccgagggctacgtt
ttctacacgtccccgaccatccaggagttcctcggcttccaccagtctgacgtcatccat
cagagcgtgtttgagctgatccacaccgacgatcgggctctcttcagaaatcagctccac
tttgctttcaacccaacaaacagccagcaagacagcggctgcgacagccccggtgaccag
aactcggtggagatcagcacaaacatgttgacctacgacccccagagcatccctccagaa
aactcctccttcctggagagaagcttctgctgtcgtttccgctgcctgctggacaactcc
tccggcttcctggcgctgaacttccacggccggctgaagttcgtccacggccagaaccag
atgtcggaagacggagcgctggtgcacccacagctggctctgttcgccatcgccacgccc
atgcagccgccgtccatcgtggagatccgcgccaagacgctgctcttccagaccaagcac
aggctggacttcacgcccatgggcatcgacaccagaggcaaaattgttctgggttacaac
gaaatcgagctgtgcatgaaaggctccggctacaacttcatccacgctgccgacatgatg
tactgcgccgacaaccacatccggatgattaaaacaggggaaagcggcttcaccgtcttc
aggctgctgaccaagagcggctcctgggtctgggtccaggccaacgccaggctggtcttc
aaggacgggaggccggacttcatcgtggctcggcagagagctctgaccaatgaagaaggc
gaggagcagctgcaccttcgccggctgcagctgccgttcaacttcaccaccggagaggcg
atgctgtacgacgtggcccccaccgtggggccgcccgactcctgctccacccccaagcag
aggaagctggacaacggctcggtcagccccaactccatcctgggctgcatgatgaaccag
gaccagtccctctaccacaacaacaacaccgtcgcctccgtggacgacctggccttcagg
gacacccacgccacgctcagcgtccccggggacgtctgggtggaccccacgggcagcctg
atgaagtcggaggccgcggtccaggacatgatggacaccctgcagcagatcctgggggag
aaccagctgagcgacactctggacgtggagcccgaggagctgaagagctgggagagcacc
ctgctgaagctgagcaccagctgcgacatgggcgacgacctctgcgacctcctcagcaac
gacgtcctgacctttgtggaggagcagctccagagggagggcgccttccagacgccccac
cagctggaggaggtcccgccctgcctggacctgcagggccgtcagagcttcagctggcct
ggagttccccaggagccggggctcagcgggaccgtgaagctcacccacatcgatcttcct
cagacttctgccggattggacgttccggctctgcagctcctcgacttccagcagagctct
ggccttccgctggagtcctgcactccggctgcgccgagggcggaggaggcgggcctccgg
gcgttctccgccaatcagaatcactgtcaccaggtgcctcggcccatccggagccacccg
gccagcgtccgggagccggaccccgttttcgccttccagggcagccactggagctccacc
cccggccagccggacccgtttgtgggttcctacgcgggtcacgtgtcgagccagcgggct
tcggggccgaccggccggggtccggctgccttcagggacactttgccctccaggagcaga
tga

DBGET integrated database retrieval system