KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00032045G001Help
Entry
GSTEN00032045G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K08830  renal tumor antigen [EC:2.7.11.22]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tng01001]
    GSTEN00032045G001
Enzymes [BR:tng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     GSTEN00032045G001
Protein kinases [BR:tng01001]
 Serine/threonine kinases: CMGC group
  RCK family [OT]
   GSTEN00032045G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo FTA2 RIO1 Pkinase_fungal Ribos_L4_asso_C
Motif
Other DBs
NCBI-ProteinID: CAG10417
UniProt: Q4RMG5
Position
10
AA seq 423 aa AA seqDB search
YKVIKKIGEGTFSEVLKTQSLKDGKFYACKTMKQTINSLEQANNLREVQAMKRLSPHANI
LQLHELILDKESGTVSLICELMEMNIYELIQGRRTPLPDHTVKNYMYQLCKSLEHMHSCG
IFHRDVKPENILIKQNCLKLGDFGSCRSIYSKPPHTEYISTRWYRAPECLLTDGYYSFKM
DMWSAGCVFFEIMSLNPLFPGANEVDQASKIHDVLGTPDPSVLRKFKQSRAMQFNFPPKK
GTGISRLVPRCPAPALSLLYQMLAYDPDERITADTALRHTYFRETRMAEKRAETFPGLPG
TLHGPEGGGSGGPPNHACRPARMGKLKGRRARRTPLPNHNTKALPAAPSRRNVPRYPAQL
PKLNLVVPGPQLPAAPGFTRRGTVPAIAPHKCQPRRVQPRDEARHAAFRSFHIPPLESRH
GGV
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
tacaaagtcatcaagaaaatcggagaggggacattttcggaggttttaaaaacacagagc
ctgaaagatggaaagttctacgcctgcaaaactatgaaacagacaattaacagcctggag
caggccaacaacctgcgggaagtccaggccatgaagaggctgagcccacacgcaaacatc
ctccagcttcatgagctcatccttgacaaagagtccggaaccgtgtccctgatctgtgag
ctgatggagatgaacatctacgagctaattcaaggccgaagaacgcccctgcccgaccac
acggtgaagaactacatgtaccagctttgcaagtcgctggaacacatgcacagctgtggg
atcttccacagagacgtgaagcccgaaaacattctgatcaagcaaaactgcctgaagctg
ggcgacttcggctcctgtcgcagcatctactccaagcccccgcacacggaatacatctcg
acccgctggtaccgggcccccgagtgcctcctcactgacggctactacagcttcaagatg
gacatgtggagcgccggctgcgtcttcttcgagatcatgagtttgaaccctctatttcct
ggagccaacgaggtggaccaggcttccaagatccacgacgtgctggggacgccggatcca
agcgtcctccggaagttcaagcagtccagggccatgcagttcaacttcccgcctaagaaa
ggcaccgggatctcccggttggtccccagatgcccggcgccagccctctcgctgctgtac
cagatgctggcctacgacccggacgagcgcatcaccgccgacacggccctgcggcacacc
tacttccgggaaaccagaatggccgagaagagagcggagacctttcccgggctccccggg
accctgcacggcccggagggcggaggctcgggcggccccccgaaccacgcctgccggcca
gccaggatggggaagctgaagggccgacgcgccagacggacacctttgcccaaccacaac
acgaaggccctcccggcggcgcccagcaggagaaacgtcccccgctaccccgcccagctg
cccaagctcaacctggtggtgcccggaccgcagctccccgccgcgcctgggttcacccgc
cgtgggacggtgccagccatcgcgccccacaagtgccaaccgcggcgggtccagccgcgg
gatgaggctcgtcacgccgccttccggagcttccacataccgccgctggagagcaggcac
ggcggcgtctga

DBGET integrated database retrieval system