KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00032217G001
Entry
GSTEN00032217G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K08268  hypoxia-inducible factor 1 alpha
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04137  Mitophagy - animal
tng04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:tng00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    GSTEN00032217G001
   04137 Mitophagy - animal
    GSTEN00032217G001
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tng03000]
    GSTEN00032217G001
Transcription factors [BR:tng03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    GSTEN00032217G001
SSDB
Motif
Pfam: PAS_3 PAS_11 PAS PAS_9 PAS_4 HLH PAS_2
Other DBs
NCBI-ProteinID: CAG10539
UniProt: Q4RM43
Position
10
AA seq 385 aa
MDTGIVPEKKRVSSERRKEKSRDAARCRRGKESEVFYQLAQELPLPHSVSSSLDKASIMR
LTISYLRMRILLNAGEPLTAEETDLDLQLNGCYLKALDGFLMVLSEDGDMIYLSENISKC
LGLAQFDLTGHSVFDFIHPCDQEELREMLIHRTESLFPLLNRHCRLISGSKKAKEPNTER
RFFLRMKCTLTSRGRTVNVKSATWKVLHCLGHVRVHESPAEPDPDGAQPSAVPYLVLICD
PIPHPANIEFPLDTKTFLSRHTMDMKFTYCDERQVIPVKWRGSPLSQLSTLTFVTPFCLS
RITELMGYDPEDLLNRSVYEYYHAQDSDHLTKTHHNLFAKGQVCTGQYRMLAKRGGFVWL
ETQATVIYNTKNSQPQCVVCVNFVL
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggacacaggaattgtaccagaaaagaaaagggtgagctcagagcggaggaaggagaag
tccagggatgcggcgcgatgtcgccgcgggaaggagtcggaggtgttttaccagctggcc
caggaactgcccctgccccacagcgtcagctccagtctggacaaggcctccatcatgaga
ctcaccatcagctacctgcgcatgaggatccttctcaatgctggcgagcccctaacggcg
gaggagacggacctggatctgcagctcaatggctgctacctgaaggctctggatggcttc
ctgatggtgctgtctgaagatggagatatgatctatctctccgagaacatcagcaagtgc
ctggggctggcgcagtttgacctgactggccacagtgtttttgacttcatacatccctgc
gaccaggaggagctgagggagatgctgatccacaggacagaaagcttgtttcctctttta
aaccgtcactgtcgtctaatttcaggctccaaaaaggccaaggaaccaaacacggaaagg
aggtttttccttcgaatgaaatgcaccctgacgagcagagggcgcaccgtcaatgttaaa
tccgctacctggaaggtgctgcactgcttgggacacgtgcgcgtccacgagagccccgct
gagccggaccccgacggagcgcagccgtcggctgtgccgtacctggtgctgatctgtgac
cccatcccccaccccgccaacatcgagttccccctggacaccaagaccttcctcagccgc
catacgatggacatgaagttcacatattgtgacgagaggcaagtcatccctgttaaatgg
cgtggatctcctctgagccagctttccaccctcacgtttgtaactcctttttgcctgtcc
aggatcactgagctcatgggctatgaccccgaggatcttctgaaccggtcggtttatgag
tattaccacgcgcaggactcggaccatctcaccaagactcaccacaacctgtttgccaag
ggccaggtgtgtacgggccagtaccgaatgttggccaagagaggcggcttcgtgtggttg
gaaactcaagccacggtcatctacaacaccaagaactcgcagccgcagtgtgtcgtctgc
gtcaactttgtgctc

DBGET integrated database retrieval system