KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00032476G001Help
Entry
GSTEN00032476G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tng01002]
    GSTEN00032476G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     GSTEN00032476G001
Peptidases [BR:tng01002]
 Serine Peptidases
  Family S33
   GSTEN00032476G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase Ndr LIDHydrolase Esterase_phd Esterase DUF1057 DUF2048 Abhydrolase_5 Abhydrolase_3 Lipase
Motif
Other DBs
NCBI-ProteinID: CAG10749
UniProt: Q4RLI3
Position
undetermined
AA seq 332 aa AA seqDB search
MELLMLSGGVLLVLVLALFLAYWLWPGVLLKAYNWFWRRRLGLVVRYSYSGGYRFCYSSR
GTPAGTTPSLLLLHGFSANKDMWLPLVMFLPRNQHVVCVDMPGHEGTSRTGAEDYSIQGQ
VSRIHQFVQSIGLDKRPFHLAGGSMGGNVAGVYAATYPQHLSSVTLICPAGLVYPKETEF
ISRLRNMEPSQQQERIALIPSTLQELEDMLELCCYNRPRLPRQVMKGLLNNRMSHNSFYK
ELFREIAGEKSRQSLQDSLHRITAPAQVIWGKEDQVLHVSGATVLQEALANCQVDLLENC
GHSVTLERPRKVANLIADFLSAQNVSGDNTKK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctcatgctgtctggaggagtcctgctcgtcctcgtcctggccttgttcctg
gcctactggctctggcctggagttctcctcaaggcgtacaactggttctggcgacggagg
ctggggctggtggtccgctactcctacagcggcggctaccgcttctgctattccagccgt
ggaacgccagcgggcaccactccgtcgctgctgctgctgcacggcttctctgccaacaag
gacatgtggctgcctttagtcatgtttcttcccaggaatcagcatgtggtgtgtgtggac
atgccgggacacgaggggaccagtcgcacgggagcggaggactacagcatccagggccag
gtctccaggattcaccagtttgtgcagagcatcggtctggataaaagacccttccacctg
gccgggggatccatgggtgggaatgtcgccggcgtctatgccgccacctacccccaacac
ctgtccagcgtcaccttgatttgcccagcaggtctggtttaccccaaagagaccgagttc
ataagtcgcctgaggaacatggagccgagccagcagcaggagcggatcgctctgatcccg
tccaccctccaggagctggaggacatgctggaactctgctgctacaaccggccccggctg
ccccgccaggtcatgaagggtctccttaacaacaggatgtcccacaacagtttctacaaa
gaactgttcagggagatcgctggggagaagtcgcgccagtcgctgcaggacagtttgcat
cgaatcacagcacctgcgcaggtgatctgggggaaggaagaccaggtgctgcacgtttcc
ggggcaacggtgctgcaggaagcgctggccaactgccaggtggacctgttggagaactgc
ggtcactccgtgacgttggagcggcccagaaaggtggcaaacctcatcgccgactttctg
tctgcacagaacgtcagcggtgacaacacaaagaaa

DBGET integrated database retrieval system