KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00033108G001Help
Entry
GSTEN00033108G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tng03041]
    GSTEN00033108G001
   03009 Ribosome biogenesis [BR:tng03009]
    GSTEN00033108G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     GSTEN00033108G001
Spliceosome [BR:tng03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    GSTEN00033108G001
Ribosome biogenesis [BR:tng03009]
 Eukaryotic type
  90S particles
   Helicases
    GSTEN00033108G001
  Pre-60S particles
    GSTEN00033108G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD DUF4217 ResIII AAA_22
Motif
Other DBs
NCBI-ProteinID: CAG11213
UniProt: Q4RK69
Position
2
AA seq 574 aa AA seqDB search
AEKKTKKVDEEEDEAPVADDEKEMDSEETEKVGEDDESEKEEDDQPELPSGLTGAFEDTS
FASLAELVSENTLKGVKELGFEHMTEIQHKTIRPLLEGRDVLAAAKTGSGKTLAFLIPCI
ELIYKLKFMPRNGTGVIILSPTRELAMQTYGVMKELMTHHVHTYGLIMGGSNRSAEAQKL
ANGINILVATPGRLLDHLQNTPGFMFKNLQCLIIDEADRILEVGFEEELKQIIKLLPKRR
QTMLFSATQTRRVEDLARISLKKEPLYVGVDDDKEKATVDGLEQGYVVCPSEKRFLLLFT
FLKKNRKKKLMVFFSSCMSVKYHYELLNYIDLPVMAIHEYIHRVGRTARGIEGRGHALLI
LRPEELGFLRYLKQAKVPLSEFEFSWSKISDIQSQLEKLIEKNYYLHKSAQEAYKSYVRA
YDSHSLKQIYNVNTLNLLMVALSFGFKVPPYVDLSILYSCSTLLKNEQKSWWYIVVIAGK
ERRSFQLCCDDLMVEPEFTLTRLLSRCAQQQRCEAAEARRGRRLWIPEVQKRSEGQNLQT
RQQTKERQQAVLPLKFPLKTSASSPSKQLKPFYT
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
gctgagaagaaaacgaaaaaggttgatgaggaggaagacgaagcaccagtagcagatgat
gaaaaagagatggattcagaagaaacagaaaaggtgggtgaagatgatgaatcagaaaag
gaggaagatgatcaacctgagctaccttctggcctgacaggcgcgtttgaagacacgtcc
ttcgcctccctcgctgagctagtgagtgagaacacactgaaaggggtgaaggagctgggc
tttgagcacatgacagagatccagcacaaaaccattcgccccctactggaggggagggat
gttttggctgctgccaaaactggaagtggaaaaactttagccttcctcatcccgtgtata
gagctcatctacaaacttaagtttatgcccaggaatggtactggtgtaatcatcctctca
cccacgcgcgagctggcaatgcagacgtacggtgtcatgaaggagctgatgactcaccac
gtgcacacctatggtctgattatggggggcagcaaccgctccgccgaggcccagaaactg
gccaacggcatcaacatccttgtggctacgcctggtcgcctgctggatcaccttcagaac
actcccgggttcatgttcaagaacctgcagtgcttgatcatcgatgaggccgaccggatc
ttggaggtgggctttgaggaagagctgaagcaaatcatcaagctgctgccgaagaggaga
cagactatgctgttctctgcaactcagaccaggagggtggaggatctcgctcgcatctcc
ctgaaaaaggagccgctctacgtcggtgtggatgacgacaaagagaaggccaccgtggac
ggcctggagcagggctatgtggtttgtccatcagagaagcggttcctcctgctctttacc
tttcttaagaagaaccgcaagaagaagctgatggtcttcttctcctcctgcatgtctgta
aaatatcactatgagctgctcaactacatcgacctccccgtcatggccatccatgagtac
atccacagggtgggccggacagccaggggcatcgagggcagaggtcatgccctgttgatc
ctgcggccagaggagctcggctttctccgctacctcaagcaggccaaggtcccgctcagt
gagtttgagttttcttggagtaaaatctctgacatccagtctcagttggaaaagctgata
gagaagaactactatctccacaagtcggcacaggaggcctacaagtcctacgtgagggct
tacgactcccactcactcaaacagatctacaacgtcaacacgctcaacctcctgatggtg
gcgctgtcctttggcttcaaagtgcccccatatgttgacctgagtatcctttacagctgc
tcaactcttctgaaaaatgaacagaaaagctggtggtatatagtagttattgcaggcaaa
gagcgccgtagtttccaactgtgttgtgatgatttgatggtggagccggagttcaccttg
actcgactcctctccagatgtgcacagcagcaaaggtgcgaagctgcagaagcgcggcgg
gggaggcggctttggataccagaagtccaaaaacgctcagaaggccaaaatcttcaaaca
cgtcaacaaacaaaggagcgacaacaggcagttctcccgctgaagtttcccctcaaaaca
tccgcttcttcaccctccaagcaattaaaacctttttacacgtaa

DBGET integrated database retrieval system