KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00033391G001Help
Entry
GSTEN00033391G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Pathway
tng04010  MAPK signaling pathway
tng04260  Cardiac muscle contraction
tng04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:tng00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    GSTEN00033391G001
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    GSTEN00033391G001
   04261 Adrenergic signaling in cardiomyocytes
    GSTEN00033391G001
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tng04040]
    GSTEN00033391G001
Ion channels [BR:tng04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   GSTEN00033391G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-ProteinID: CAG11424
UniProt: Q4RJK8
Position
3
AA seq 82 aa AA seqDB search
PLLSLPIMFIAFILNVWTILAFVSGIFFILSGLALVVGLVLGISRISQEVLNRTRSGEAF
LTCKYGWSFAFAALCFLLTEVR
NT seq 246 nt NT seq  +upstreamnt  +downstreamnt
cctctgctcagcctccccatcatgttcatcgccttcatcctcaacgtctggaccatcctg
gccttcgtctctgggatcttcttcatcctctcaggtctggctctggtggtgggtctggtt
ctgggcatctccagaataagccaggaggttctgaacaggactaggagcggcgaggccttc
ctcacctgcaaatatggatggtcctttgccttcgctgccctctgcttcctgctcacggag
gtgaga

DBGET integrated database retrieval system