KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00033497G001
Entry
GSTEN00033497G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GSTEN00033497G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     GSTEN00033497G001
SSDB
Motif
Pfam: AstE_AspA
Other DBs
NCBI-ProteinID: CAG11516
UniProt: Q4RJB6
Position
18
AA seq 158 aa
MTSAPVRAIFVDLPASEAYSLESVGKHGFAIEVGPQPNGVLRADIYNLMKEALDLTFEFV
QEFNAGHTFEGGQVEAYMMEDPVDYPRDPTTGEITASVHSQLQDKDFKLLKPGDPIFKKF
SGETVTYEGEELYSFFINECAYYEKKIAFLLGEKVRLD
NT seq 474 nt   +upstreamnt  +downstreamnt
atgacctctgcacccgtccgggcgatcttcgtcgatttgccggcctccgaagcctattcc
ctggagtctgtggggaagcacggtttcgccatagaagtcggccctcagcccaacggtgtc
ctcagagcggacatctacaacctgatgaaggaggccctggatctcacctttgaatttgtc
caggaattcaatgcaggacacactttcgaagggggtcaggtggaagcgtacatgatggag
gaccctgtggactatccaagggaccccacaaccggagagatcactgcatccgttcactcc
cagctgcaggataaggacttcaaactcctcaaaccaggcgaccccatattcaagaaattt
tcaggcgaaacggtgacctacgaaggagaagaactctactcgtttttcataaacgaatgc
gcgtactatgagaagaagatcgcttttctcctgggggagaaggtcaggctggac

DBGET integrated database retrieval system