KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00033579G001Help
Entry
GSTEN00033579G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tng04131]
    GSTEN00033579G001
Membrane trafficking [BR:tng04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    GSTEN00033579G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DOCK_N
Motif
Other DBs
NCBI-ProteinID: CAG11578
UniProt: Q4RJ54
Position
1
AA seq 1940 aa AA seqDB search
MSIDDTPRGSWACSIFDLKNSLPDVLLPHLLDRAPNEEIDRHNEDQRKCNRNRELFALYP
ALDEEEPIERHCVPEVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENF
FFDLNSEQMKAMLRPHVQTAAISTLARSAIFSITYPSQDVFLVIKLEKVLQQGDIGECAE
PYMVMKESDATKNKEKLEKLRSQSEQFCQRLGRYRMPFAWTAIHLMNIVNSAGSLERDTE
LEMSLSERKGSWSERRNSSIMGRRSLERTTSGDESCSLTGFRPATLTITNFFKQEGDRLS
DEDLYKFLADMRRPSSVLRRLRPITAQLKLDISPAPENPHYCLTPDLLQVKPYPDSRVRP
TREILEFPARDVYVPNTTYSPRNQYAGHKPPAENLLYVYPQSLNFANRQGSARNITVKVQ
FMNGEDPNNAMPVIFGKSSCADFFKEAYTSVVYHNRSPDFHDEIKIKLPASLSDHHHILF
TFYHVSCQQKQNTPLETPVGYTWIPMLQNGRLRTGHFCLPVSLEKPPQSYSVLSPDVPLP
GMKWVDNHRGVFNVEVVTVSTIHTQDQYLDKFFALVHALDEHMFPVRIGDMRIMENNLEA
ELKSSIAALNSAQLEPVVRFLHLLLDKLVLLVVRPPVIAGQIVNLGQASFEVMATIANRL
YKYLDTSQDMHGRNGLLSSYIHYVFRLPSTDPNSPSPGPGGLGGSVHYATMARSAVRPAS
LNLNRSRSLSNSNPDISGTPTSPDDEVRSIIGSKGLDRSNSWVHTMGCKSAPWGSSPGSA
PETMQLFHEELALQWVVSSGSIREGALQQAWFFFELMVKSIIHHLYFTDRLESPRKNRFP
ERFMDDITALVSTIAGDIVSRFQKDLELVERLNTSLAFFLNDLLSVMDRGFVFTLIRARL
ALFSQVSTKLYALQNPTLESLRLDFLRIICSHEHYVTLNLPCCLLTPPASPSPSVSSATS
QSSGFSTHVQDQKIANMFELSTPFREQHFLAGLVLSELSVILDPDNEGMFGLHKKVVSVV
HNLLSSHDSDPRYADPEVKARVAMLYLPLIGIVMETLPQLYDFSESHNQWGRPGGPQGAA
MGCTGEDAESEANSLISQTVAMAIAGTSTASPISRPSSFLLNSQASRQHGSFTAESSRSL
LICLLWVLKNADEMVLQKWFTDLSVSQLNRLLDLLFLCVSCFEYKGKKAFERMNSLTFKK
SKDMKAKLEEAILGSIGARQEMVRRSRGQLERSPSGSFGSQENLRWRKDMTHWRQNNEKM
DKTRAELEHEALIDGNLATEANLIILDTLEIIVQTVSVTESKESILGGVLKVLLHSMACN
QSALYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRSCSSSISIIRAHASASLYL
LMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEFLRRSLKTILTYAEEDLELRETTF
PDQVQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIAKGYQTSPDLRLTWLQNMAGKH
SERNNHAEAAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNVLEESAVSDDVVSP
DEEGICSGKYFTEIGLVGLLEQAAASFSMAGMYEAVNEVYKVLIPVHEANRDAKKLATIH
GKLQEAFSKIVHQDGKRMFGTYFRVGFYGSKFGDLDEQEFVYKEPAITKLAEISHRLEGF
YGERFGEDQVEVIKDSNPVDKCKLDPNKAFVQITYVEPYFDTYEMKDRITYFDKNYNLRR
FVYCTPFTLDGRAHGDLHEQYKRKTILTTSHAFPYIKTRINIIHKEEVQMSPALRVGAVI
ISTPIEVAIEDMQKKTQELAFATHQDPADAKMLQMVLQGSVGTTVNQGPLEVAQVFLSEI
PSDPKLYRHHNKLRRVFQGLHQTFLMVHLRDRCEDALRKNKSLIGPDQKEYQRELERNYH
RLKEALQPLINRKIPQLYKP
NT seq 5820 nt NT seq  +upstreamnt  +downstreamnt
atgtccattgatgacaccccacgtggcagctgggcctgcagcatctttgacttgaagaat
tcccttcctgacgtgctccttccgcaccttcttgaccgagctcccaatgaggagattgac
aggcacaacgaggaccagcgcaagtgcaaccgcaaccgggaactctttgctttgtacccg
gccctcgatgaggaagaacccattgagcgccactgtgtgcctgaagtgcctaaagaacat
tttggccagaggctacttgtcaagtgcttatccttgaagttcgagattgaaattgaacca
atatttgcaagtttggccttatatgatgttaaggaaaagaaaaagatttcagaaaacttt
ttttttgaccttaactctgagcaaatgaaagcaatgctgcgaccacatgtacagactgca
gcaatctccacactggctcgatctgcaatattttccatcacttatccctcacaggatgtc
ttccttgtcattaagctggaaaaagtactgcagcaaggtgatattggagaatgtgctgag
ccctatatggtgatgaaagagtcagatgctacgaagaataaagagaagctggagaagctt
cgcagccagtcggagcagttctgccagcgtcttggccggtatcgtatgccatttgcctgg
actgccatccacttgatgaacattgtaaacagtgctggtagtctggagagagatactgag
ctggagatgagcctgtcagaaagaaaaggctcctggtcagaacggaggaattcaagcatc
atgggaaggcgttctttggagaggaccaccagtggagatgaatcctgcagtctgacgggc
tttagacctgcaacactgaccatcaccaatttctttaaacaggagggagacagattgagt
gacgaagacttatacaagttcctagctgatatgagaaggccttcctcagtgctgaggaga
ctcagaccaataactgctcagttgaagttggacatttctccagctccagagaaccctcat
tattgtttgacccctgacctcctccaagttaagccttacccagacagcagggtacgcccc
accagggagatcttggagttccccgccagagatgtctacgtgccaaataccacatacagt
cctcgaaatcaatacgcaggacataagccccctgctgagaatcttctatacgtgtacccg
cagagtctgaactttgccaatcgccaaggatctgcccgcaacatcacagtcaaagtgcaa
tttatgaacggagaggatccaaacaatgcaatgccggtgatatttggaaaatctagctgc
gcagatttcttcaaagaagcctacacttctgtggtctaccataaccggtctccagatttt
cacgatgagatcaagattaagcttcctgcctcgctgtctgatcaccaccacattttgttc
actttttatcatgtcagctgccagcaaaagcagaatacaccgttggagacccctgtggga
tacacgtggatccccatgctgcagaatgggcgcctgagaacaggacacttctgtttgcct
gtatctctggaaaaacccccacagtcctattctgtgctgtcacccgatgttcctctccca
ggaatgaagtgggtggacaaccatcgaggagtgtttaatgttgaagtggtcactgtttca
accattcacactcaggaccagtatcttgataagttctttgccttggtgcacgctctggac
gagcacatgttcccagtcaggataggagacatgcgcatcatggaaaataacctggaagcc
gagctcaaatccagcattgcagcactcaactctgcccagctggagcccgtggtccgattt
cttcaccttctacttgacaagttggtattgctggtcgtgaggccgccagtcattgccggg
cagatagtgaatctgggccaggcatcattcgaggtcatggcaaccattgcaaaccggctc
tataaatacctggacaccagccaggacatgcatggccgtaatggcttgctgtcctcttac
atccactatgtgttccgcttgcccagcactgaccccaactcaccctctccaggtccggga
gggttgggaggttcggttcattatgcaaccatggctcgctcagctgttcgtccagccagc
ctcaatctgaaccgttcccgcagcctcagcaacagcaaccctgacatctccggaaccccc
acgtctccagatgatgaggtccgctccatcatcggcagcaagggcttagaccgctccaac
tcgtgggtgcacaccatgggctgtaagagtgccccctggggatccagccctgggtccgct
ccagaaaccatgcagctcttccatgaagagctggccctccagtgggtggtgagcagcgga
agcatcagagaaggcgccctacagcaggcctggtttttctttgagttgatggtgaagagc
attattcaccacttgtacttcaccgatcgcttggagtcacccaggaagaatcgtttcccc
gaacgcttcatggatgacatcacagccctggtcagcaccattgcgggtgacatcgtatct
cgtttccagaaggacctggagttggtggagagactaaacacaagcctggcgttctttctt
aatgatttgctgtcggtcatggacaggggcttcgtcttcacactgatcagagcacgtctc
gctttgttttcccaggtgtcgacaaagctttatgctctacagaacccaaccttggagtct
ttgaggctggactttctgcggataatttgtagccatgaacactatgttacactcaacctg
ccttgctgtctgctcaccccacctgcctcaccctcaccctccgtgtcttcagcgacctcg
cagagttctggattttccacacatgtccaggaccaaaagatagccaatatgtttgagctg
tctacccccttcagggaacaacactttctggctggactggtgctgtctgaactgtctgta
atactggacccagataatgaagggatgtttggcctccataaaaaagtggttagtgtcgtt
cacaatctcctctccagccacgactctgacccacgctatgcagaccctgaggtgaaggcc
agagtggccatgctttacctgcctctcattggcattgtcatggaaacactaccacaactc
tatgacttttcagagtcccacaaccagtggggtcgcccaggcggtccacagggtgcagca
atgggctgcactggtgaagatgctgaaagtgaggctaacagcctaatcagccagactgtt
gccatggcaatagcaggcacctctactgcttccccaatatctcgaccgagtagcttcttg
ctgaactcgcaggcgagtcgtcaacacggtagcttcacggctgagtcgagtcgcagtctt
ctcatctgtctgctgtgggtactgaagaatgctgatgagatggtgttacagaaatggttc
acagatttgtctgtgtcacagctgaaccgtctgctggatctcctcttcctctgtgtctct
tgctttgagtacaagggaaagaaggcgtttgaaagaatgaacagtttgacttttaagaag
tccaaagacatgaaagccaaattggaggaagccatactgggcagcatcggtgccaggcag
gagatggtgcgacgcagcaggggacaactagaacggagcccgtctggcagcttcggcagt
caggagaatcttcgatggagaaaggacatgacccactggaggcaaaataatgaaaagatg
gacaagaccagagcggagctagaacatgaagcgcttatcgatggaaatcttgcaacagag
gccaacctaattatcctggacactttagagattattgtgcagacggtatcagtgacagag
tcaaaggagagcatccttggtggagttctgaaggtgctgctccacagcatggcctgcaac
cagagcgccctctacctccagcactgctttgccacacagagggccctggtatcaaagttc
cctgagctgctgtttgaggaggagacggagcagtgcgctgacctgtgtctgagactgttg
aggagctgcagcagcagcataagcatcattagagcccacgccagtgcttccctctaccta
cttatgagacaaaactttgagattggcaataactttgcaagagtcaagatgcaggtgacc
atgtcgctttcatcactggtgggaacctctcagaatttcaacgaggagtttttacgccgc
tctctgaagaccatcctcacctatgcagaagaagacttggagctgcgagagaccacgttt
ccagaccaggttcaagacctcgtgtttaatctgcacatgatcctgtctgacacagtcaag
atgaaggagcaccaagaagaccccgaaatgctaatagatctaatgtacaggattgctaag
ggttaccagacgtcaccagacttgcggctgacttggctgcagaacatggctggaaaacac
tcggagaggaacaaccacgccgaggcggctcagtgtctcgttcacagcgctgctctggtg
gcagagtacctgagcatgctcgaggaccggaagtatctgcccgtgggctgcgtcaccttc
cagaatatttcctccaatgtgctggaggaatctgcagtgtctgatgatgtggtgtcaccg
gatgaggagggcatatgctcagggaagtacttcacggaaatcggcctcgtgggcctcctg
gagcaggcggctgcttctttctcgatggcgggcatgtacgaggcagtaaatgaagtgtac
aaggtactcatccctgtccacgaagccaacagggatgccaagaagttagccaccattcat
ggtaaactccaggaggcattcagcaaaattgtacatcaggatggaaagcggatgttcggg
acctactttagagtcggcttttacggctccaaattcggcgacctggacgagcaggagttt
gtgtacaaagagccagccatcaccaagctggccgagatctcccacaggctggagggcttt
tatggggagcgctttggagaagaccaggtcgaggttatcaaggactcaaaccccgtggac
aagtgcaagctggacccaaacaaggcgttcgtccagatcacgtacgtggagccgtacttc
gacacctacgagatgaaggaccgcatcacctacttcgacaagaactacaacctccgccgc
ttcgtctactgcacccccttcacgctggacggacgggcgcacggcgacctgcacgagcag
tacaaacgcaagaccatcctcaccacctcccacgccttcccctacatcaagacgcgcatc
aacatcatccacaaggaggaggtgcagatgagcccggccctccgcgtcggcgccgtgatt
atctccacgcccatcgaggtggccatcgaggacatgcagaagaagactcaggagctggcc
ttcgccacgcaccaggacccggccgacgccaagatgctgcagatggtcctgcagggatca
gtgggaacgactgtcaaccagggtcctttggaagtggctcaggttttcctgtcagagatt
cccagcgatccgaagctgtacagacaccacaataagctacggcgtgtgtttcaaggactt
caccaaacgttcttgatggtccatctgcgtgacaggtgcgaagatgccctgcgcaagaac
aagagcctgatcgggccggaccagaaggagtaccagagggagctggagaggaactaccac
cgcctgaaggaggcgctgcagcccctcatcaacaggaagatccctcagctttataaacct

DBGET integrated database retrieval system