KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00033580G001Help
Entry
GSTEN00033580G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tng04131]
    GSTEN00033580G001
Membrane trafficking [BR:tng04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    GSTEN00033580G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3398
Motif
Other DBs
NCBI-ProteinID: CAG11579
UniProt: Q4RJ53
Position
1
AA seq 144 aa AA seqDB search
AMAERRAFAQKISRTVAAEVRKQIAAQYGGSPLLFKNLNVGTATSNTVPLTEAVEPVDFE
EYLNTHPPIVESGPLRDLIEFPQDDIEVIYSLRECRTVAQGVPEEGDTDAHVRDCVRSYT
EDWALVNRRLLSMKLFVNNNSYNY
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
gccatggctgaacgccgcgccttcgcccagaaaatcagcaggactgtggcagcagaggtt
agaaaacagatagctgcccagtatggtggttcaccactactcttcaaaaacctcaacgtg
gggaccgcaacaagcaatacagttcctctcacagaagctgttgagccagtggattttgag
gagtatcttaacactcacccgcctattgttgaatctggccccctgagagatctgattgag
tttccccaagatgatatcgaggtcatctactcactcagggagtgtcgcacagtagcacaa
ggcgttccagaggaaggggatactgatgctcacgtcagagactgcgtccgatcctacaca
gaagactgggccctagtcaacagaaggttgctatcaatgaagctttttgtaaataataac
agttacaactactaa

DBGET integrated database retrieval system