KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00033806G001Help
Entry
GSTEN00033806G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tng01002]
    GSTEN00033806G001
Enzymes [BR:tng01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     GSTEN00033806G001
Peptidases and inhibitors [BR:tng01002]
 Metallo peptidases
  Family M49: dipeptidyl-peptidase III family
   GSTEN00033806G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-ProteinID: CAG11740
UniProt: Q4RIP2
Position
7
AA seq 716 aa AA seqDB search
MVDSQYYLPNDVGVSALDCAEAFRLLSPQEKMYAHYMSRAAWYGGLAVLLQTSPESADIF
VLLQRIFRKQTPAQLEPVATAAGLSPEEYQAFLVYAAGLYANMGNYKSFGDTKFIPNLPK
DKLEALVKASQAFQEQPSEMEALWRGCSCSMYSLEDRQKQLGLGDKGITTYFSGNCCLED
AELAQKFLDSKKLSAYNTRLFKRESGGKACYEVRLASAVQKDCAVDGECDSCCGCFNFED
KEFSVKRGDYAPLMEKVSHYLQQAQAYAANENQRRMLEEYRRSFTFGSIEAHKEGSRYWI
KDKGPIVESYIGFIESYRDPFGSRGEFEGFVAVVNKAMSERFAKLVSSAEVLLPELPWPV
EFEKDTFLKPDFTSLDVLTFAGSGIPAGINIPNYDDIRQSEGFKNVSLGNVLAVAYATQK
EKLTFLEEEDKDAFIKWKGPSFEVQVGLHELLGHGSGKLFVQDDNGKFNFDQGKVSSWYR
GSETWDSKFSTIASSYEECRAECVGLYLCLNKEVLSIFGHEGQDADDVVYINWLSMVRAG
LLGLEFYTPESRSWRQAHMQARFVILRVLLEAGEDLVSLEEVTGQDGKPDARIRLDRSKI
PTVGKSAIHRFLCKLQVFKSTADVEGGRVLYDKYSTVSDSGTHNFLRLRETVLLRKEARK
MFVQANTKINGDAVELVEYESSAAGLICSFIERFQDDVEKLESDLLEMSRNDAPCW
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggtggactcccagtactacctacccaatgacgtcggcgtgtcggcacttgactgcgcc
gaggccttccgtttgctttcgccacaggagaagatgtacgcacattacatgtcacgggct
gcttggtacggtggtttggcagtgctgctgcagacttctccagagtctgcggatattttt
gtcctgctgcagaggatcttccggaagcagacgcctgcacagctggaacctgttgccaca
gcagctggactgagccctgaggagtaccaggccttcttggtatatgcggctggtctctat
gccaacatgggaaactacaagtcttttggggacaccaagttcattccaaaccttccaaag
gacaagctggaggctctggtgaaggccagccaggctttccaggagcagcccagtgagatg
gaggctctgtggaggggttgctcctgctccatgtactccctggaagacagacagaaacaa
ctgggcctgggtgacaagggaataacaacctacttctcaggaaactgctgtctggaagat
gctgagctagctcagaaattccttgattcaaagaaattgtctgcctacaatactcgtcta
ttcaagagggagagtggcggcaaagcctgctacgaagtgcgcttggcctcagctgtgcag
aaagattgtgcagtggatggtgaatgtgattcgtgctgtggctgtttcaactttgaagac
aaagaattctcagtaaaaagaggagactacgctcctctcatggagaaagtcagccattac
ctccagcaagcgcaggcttacgctgccaacgagaaccagaggaggatgcttgaggaatac
agacgtagcttcacttttggctctattgaagcccataaagaaggctcgcgctactggatc
aaagacaaagggccgattgttgaaagctacattggtttcattgaaagctaccgagaccct
tttggctcaagaggagagtttgaaggtttcgtcgccgtggtgaacaaggccatgagtgag
cgttttgccaaactggtgagctcggctgaagtcctgctccccgagctgccctggcctgtg
gagtttgaaaaggacactttcctcaaaccggatttcacctctctggatgtcctcaccttc
gctggcagcggaattccagctggcatcaacataccaaactatgatgacatcagacagtcg
gagggcttcaaaaacgtgtctcttggcaacgtgttggctgtggcctatgctacacagaaa
gaaaaactcacttttttggaggaagaagacaaggacgcatttatcaagtggaagggacct
tcttttgaggtgcaggtcggactgcatgagttgttgggacatggaagtggcaaactgttt
gtccaggacgacaacggcaagtttaactttgaccaaggaaaggtgtccagttggtatcga
ggcagcgaaacgtgggacagcaaattctccaccatcgcttcctcctatgaggaatgccgg
gccgagtgtgtgggcctgtacctgtgcctcaacaaggaggtgctcagtatttttggccac
gagggccaggatgcagatgacgtggtctacatcaactggctcagcatggtccgagccggt
ctgctgggcctggagttctacacgcctgaaagccggagctggagacaggctcacatgcag
gctcgtttcgtcatcctacgtgttctgctggaggccggggaggacctggtgagcctggag
gaggtgacagggcaggacggaaaacccgatgctcggatcagactggaccgaagcaagatc
cccaccgtgggcaagagcgccattcacaggttcctctgtaagctgcaggtgtttaaatca
acagcagatgtggaaggaggcagggttctctacgacaagtattccacggtcagcgacagc
ggcacgcacaacttcctgcgtctgcgggaaacggtgctgctcaggaaggaagctcgtaag
atgtttgtccaggccaacaccaaaatcaacggggacgctgtagagctagtagagtatgaa
agcagtgcagccggtttgatttgctcttttatcgagcgtttccaagacgacgttgagaag
ttggagtctgaccttctggagatgagccgaaacgacgccccctgctgg

DBGET integrated database retrieval system