KEGG   Tetraodon nigroviridis (spotted green pufferfish): GSTEN00034396G001Help
Entry
GSTEN00034396G001 CDS       T04346                                 

Definition
(GenBank) unnamed protein product
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
tng  Tetraodon nigroviridis (spotted green pufferfish)
Brite
KEGG Orthology (KO) [BR:tng00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tng04131]
    GSTEN00034396G001
Membrane trafficking [BR:tng04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    GSTEN00034396G001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOCK-C2 DUF3398 Peptidase_C33 DOCK_N
Motif
Other DBs
NCBI-ProteinID: CAG12198
UniProt: Q4RHD4
Position
3
AA seq 782 aa AA seqDB search
MGRGYFEGDPTIVNSRMQEKGVNGTVAAEVRKQVSREYGSPQLTKKRGGVSNPLSLSEVV
EPVDFEEYVSSHAPGVEPGPLRQLMEFPQDDLELLHLDKECITLEPRVPDEEDSLDPRVR
DALSVYTDDWLVIQRKYRHYSTTFTPHSSERQRERQRGLVKQTFELDVTTTDHQDDQDDA
KRRSVGLDETPRGSWASSIFDLKNSTPDALLPSVLERTALEDMDHCNTEARQQGRHSDLL
GLYPPPDEDEAVERCSTVDVPKEHCGQRIMVKCLALKFEIEIEPIFGILALYDIKEKKKI
SENFYFDLNSDQMKGLLKPHTPHIAISTLARSAIFSITYPSADIFLVIKHKEKLEKLRLQ
AEQSCNRLGRFRMPFAWTAIHLVNVVSSMGSLDRSDPDSDSEKKGHGTWNERKKKTFERM
SIADDMCNFATFRPATLTVTNFFKQEGDRLSDEDLYKFLADMRRPSSVLRRLRPVTAQLK
IDISPAPDLPHYCLSPELLHVKPYPDPRVRPTKEVLEFPARDVYTPHTTYRNLLYVYPKS
LNFSSRQGSVRNIAVKVQFMAGEDPSQALPVIFGKSSCAEFTNETYSPIIYHNKSPEFYE
EMKMKIPANLTDNHHLMFTFYHISCQPKQNTPLETPVGYTWIPLMQHGRLKTGSFSLPVS
VEKPPPSYSVLTPDVQLPGMKWVDNHKGVFSVEVTAASSVHTQDPFLDKFFTLVYVLEEY
SFPFRLKDVIITESNMEAELKSSMVALRGALLDTCVSFLHQLLNKIIQLIVFPPVIGGQI
GK
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgaggctactttgagggggacccgaccattgtaaattccaggatgcaggaaaag
ggtgtgaatgggacggtagctgctgaggtgaggaaacaagtgtcccgagaatatggatcc
cctcagctgaccaaaaaacgaggaggcgtctccaaccctttgtccctgtcagaggtggtg
gagcctgtggattttgaggagtatgtgagcagtcatgctcctggggtggagccggggccc
ctcagacagctcatggagttcccccaggacgacctggagctcctccacctggacaaggag
tgcattaccctggagccacgggtgcccgatgaagaggattcactggatcccagagtgaga
gacgccttgtcggtctacaccgacgactggctcgtcattcaaagaaaatatcgacattac
agcaccacattcacacctcacagctccgagagacagagagagaggcagcgagggctggtc
aaacagacctttgagctggacgtgacgaccaccgatcaccaggacgaccaggatgacgca
aagcggcgctccgtcggcctggatgaaacccctcgagggagctgggcctccagcattttt
gacctgaagaactctaccccggatgcccttttaccctctgtgttagagcgcacagctctg
gaggacatggaccactgcaacaccgaggcgcgccagcaggggcgccacagtgacctgctg
ggcctgtaccctccccctgatgaggatgaggctgtcgagagatgctccactgttgacgtg
cccaaggagcactgtggccagaggattatggtgaagtgtctggctctgaagtttgaaata
gaaattgagccaatatttggaattcttgccctgtatgacatcaaggagaagaaaaagatc
tctgagaatttctacttcgacctgaactcggatcagatgaaggggctgctcaaaccgcac
acgcctcacatcgccatttctaccctggcccgttctgctattttctccatcacataccca
tctgccgatatcttcttggtcatcaagcataaagagaagttggagaagctgcgtctgcag
gcagagcagtcatgtaaccgcctcggacgcttccgtatgccttttgcctggacagccatt
cacctggtcaacgttgtcagcagtatgggcagtctggatcggtccgatcccgactctgac
tctgagaaaaaaggccatgggacatggaatgagagaaagaaaaagacctttgagcggatg
agtatagcagatgacatgtgcaattttgctaccttccgtcctgccacgttaaccgtcacc
aacttcttcaaacaggagggagacagactaagtgacgaggacctctataagtttttggca
gacatgcgcagaccatcctctgttctgcgacggctgaggcctgtcacagcccagttgaag
attgacatctctccagctccggatttgcctcattactgcctgtcaccagaactgcttcat
gtaaaaccttacccagacccacgtgtccgcccaaccaaggaagtgctggagttcccagct
cgtgatgtctacaccccacataccacctacaggaatttgctctatgtttacccaaaaagc
ttgaacttcagtagtcgtcagggctcagtgaggaacatcgctgtcaaagtccagttcatg
gcaggagaggaccccagtcaagctttgccggtcatcttcgggaagtcgagctgtgctgag
ttcacaaatgagacttacagtcccatcatctaccataacaagtcccctgagttttatgaa
gagatgaagatgaagattcctgccaatctgactgacaatcaccacctcatgttcaccttc
taccacatcagctgccagcccaaacaaaacactcctctggagactcctgtaggctacact
tggatccctttgatgcagcacggccgactaaaaacaggctccttcagtttacctgtctcg
gtagaaaagcccccaccgagctactctgtgctcacccctgatgttcagcttccaggcatg
aagtgggtggataatcacaaaggcgtgttcagtgttgaagtgacagcagcctcttcagtt
cacactcaggaccccttcctggataagttcttcacactggtgtacgttctggaagagtat
tcttttcccttccgcctgaaggacgtgatcattactgagtcaaacatggaggcagagtta
aagagcagcatggtggcattgagaggggccctgctagacacctgtgtcagtttcctgcac
cagctgctcaacaagatcatccaacttatcgtttttccaccggtcattggaggccaaatt
ggtaaatga

DBGET integrated database retrieval system